![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 896042 | ||||||||
Common Name | ARALYDRAFT_896042 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 163aa MW: 18935.3 Da PI: 9.5508 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 99.9 | 1.6e-31 | 82 | 140 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK vk+++fprsYY+Ct +gC+vkk+v+r d+ vv++tY+g H+h+ 896042 82 LDDGYRWRKYGQKAVKNNPFPRSYYKCTEEGCRVKKQVQRLWGDEGVVVTTYQGVHTHP 140 59********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 7.7E-33 | 67 | 140 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 8.37E-29 | 74 | 141 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 30.125 | 77 | 142 | IPR003657 | WRKY domain |
SMART | SM00774 | 4.2E-37 | 82 | 141 | IPR003657 | WRKY domain |
Pfam | PF03106 | 2.1E-25 | 83 | 140 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0006817 | Biological Process | phosphate ion transport | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008134 | Molecular Function | transcription factor binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 163 aa Download sequence Send to blast |
MEDRRCQVLF PCSSSVDPRL TEYHGVDNSA ECADQLTTSS LSQQNMNTNE EEKPKSKKKK 60 KKKKKEREAR YAFQTRSQVD ILDDGYRWRK YGQKAVKNNP FPRSYYKCTE EGCRVKKQVQ 120 RLWGDEGVVV TTYQGVHTHP VDKPSDNFNH ILTQMHIFPP FS* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 1e-27 | 72 | 139 | 7 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 1e-27 | 72 | 139 | 7 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 56 | 64 | KKKKKKKKK |
2 | 58 | 64 | KKKKKKK |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. {ECO:0000250|UniProtKB:Q9SI37}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00325 | DAP | Transfer from AT3G01970 | Download |
![]() |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 896042 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF426251 | 1e-136 | AF426251.1 Arabidopsis thaliana WRKY transcription factor 45 (WRKY45) mRNA, complete cds. | |||
GenBank | AK118457 | 1e-136 | AK118457.1 Arabidopsis thaliana At3g01970 mRNA for putative WRKY-like transcriptional regulator protein, complete cds, clone: RAFL19-70-A15. | |||
GenBank | AY085246 | 1e-136 | AY085246.1 Arabidopsis thaliana clone 1415 mRNA, complete sequence. | |||
GenBank | BT024684 | 1e-136 | BT024684.1 Arabidopsis thaliana At3g01970 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002882154.1 | 1e-121 | probable WRKY transcription factor 45 | ||||
Swissprot | Q9S763 | 8e-84 | WRK45_ARATH; Probable WRKY transcription factor 45 | ||||
TrEMBL | D7L9J2 | 1e-119 | D7L9J2_ARALL; Uncharacterized protein | ||||
STRING | scaffold_300012.1 | 1e-120 | (Arabidopsis lyrata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM509 | 28 | 154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G01970.1 | 7e-85 | WRKY DNA-binding protein 45 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 896042 |
Entrez Gene | 9318221 |
Publications ? help Back to Top | |||
---|---|---|---|
|