PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

MYB

Protein Properties

Length: 249aa MW: 28314.2 Da PI: 7.9965

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
894283	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	52.1	1.5e-16	10	57	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd ll +++ ++G g W+ ++ + g++R++k+c++rw++yl 894283 10 KGAWTAEEDSLLRKCIDKYGEGKWHQVPLRAGLNRCRKSCRLRWLNYL 57 79********************************************97 PP
2	Myb_DNA-binding	51	3.4e-16	63	108	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+++t+E +ll++++k+lG++ W++Ia +++ Rt++++k++w+++l 894283 63 RGKFSTDEVDLLLRLHKLLGNR-WSLIAGRLP-DRTANDVKNYWNTHL 108 89******************.*****.**********996 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	24.854	5	61	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	1.0E-21	5	60	IPR009057	Homeodomain-like
SuperFamily	SSF46689	2.93E-28	8	104	IPR009057	Homeodomain-like
SMART	SM00717	2.2E-14	9	59	IPR001005	SANT/Myb domain
Pfam	PF00249	1.9E-15	10	57	IPR001005	SANT/Myb domain
CDD	cd00167	1.60E-10	12	57	No hit	No description
Gene3D	G3DSA:1.10.10.60	2.4E-22	61	111	IPR009057	Homeodomain-like
SMART	SM00717	2.0E-15	62	110	IPR001005	SANT/Myb domain
PROSITE profile	PS51294	19.17	62	112	IPR017930	Myb domain
Pfam	PF00249	7.4E-15	63	108	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 249 aa Download sequence Send to blast
MEATSNGLTK GAWTAEEDSL LRKCIDKYGE GKWHQVPLRA GLNRCRKSCR LRWLNYLKPS 60 INRGKFSTDE VDLLLRLHKL LGNRWSLIAG RLPDRTANDV KNYWNTHLSR RHELFCSSKM 120 KTKNITSPPT TPVQKIEVLK PRPRSFSVKN ACSHLNGFPK VDVIPPCSGL NNNYVCESSI 180 ICGEDEKNYE SVYKNLMDKD NMWLKSLLES HEVDALGPEA TTTENGATLE FDVEQLWNLF 240 DGETVELD*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	9e-21	8	111	5	107	B-MYB
1gv2_A	9e-21	8	111	2	104	MYB PROTO-ONCOGENE PROTEIN
1h88_C	4e-20	8	111	56	158	MYB PROTO-ONCOGENE PROTEIN
1h89_C	4e-20	8	111	56	158	MYB PROTO-ONCOGENE PROTEIN
1mse_C	1e-20	8	111	2	104	C-Myb DNA-Binding Domain
1msf_C	1e-20	8	111	2	104	C-Myb DNA-Binding Domain
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator, when associated with BHLH12/MYC1, EGL3, or GL3. Promotes the synthesis of phenylpropanoid-derived compounds such as anthocyanins. {ECO:0000269\|PubMed:11148285, ECO:0000269\|PubMed:15361138}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	894283

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By sucrose, nitrogen deficiency, ethylene, UV light and drought. {ECO:0000269\|PubMed:17053893, ECO:0000269\|PubMed:9839469}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002887034.1	0.0	transcription factor MYB114
Swissprot	Q9ZTC3	1e-125	MYB90_ARATH; Transcription factor MYB90
TrEMBL	D7KTP4	0.0	D7KTP4_ARALL; Uncharacterized protein
STRING	scaffold_201357.1	0.0	(Arabidopsis lyrata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4	28	2646

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G66390.1	1e-127	myb domain protein 90

Link Out ? help Back to Top
Phytozome	894283
Entrez Gene	9323099

Publications ? help Back to Top
Ilk N,Ding J,Ihnatowicz A,Koornneef M,Reymond M Natural variation for anthocyanin accumulation under high-light and low-temperature stress is attributable to the ENHANCER OF AG-4 2 (HUA2) locus in combination with PRODUCTION OF ANTHOCYANIN PIGMENT1 (PAP1) and PAP2. New Phytol., 2015. 206(1): p. 422-35 [PMID:25425527] Li T, et al. Jasmonic acid enhancement of anthocyanin accumulation is dependent on phytochrome A signaling pathway under far-red light in Arabidopsis. Biochem. Biophys. Res. Commun., 2014. 454(1): p. 78-83 [PMID:25450360] Nemie-Feyissa D,Heidari B,Blaise M,Lillo C Analysis of interactions between heterologously produced bHLH and MYB proteins that regulate anthocyanin biosynthesis: quantitative interaction kinetics by Microscale Thermophoresis. Phytochemistry, 2015. 111: p. 21-6 [PMID:25659750] Bac-Molenaar JA,Fradin EF,Rienstra JA,Vreugdenhil D,Keurentjes JJ GWA Mapping of Anthocyanin Accumulation Reveals Balancing Selection of MYB90 in Arabidopsis thaliana. PLoS ONE, 2015. 10(11): p. e0143212 [PMID:26588092] Mondal SK,Roy S Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275] Li N, et al. The heterologous expression of Arabidopsis PAP2 induces anthocyanin accumulation and inhibits plant growth in tomato. Funct. Integr. Genomics, 2018. 18(3): p. 341-353 [PMID:29372433]