PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 892661 | ||||||||
Common Name | ARALYDRAFT_892661 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 78aa MW: 9083.61 Da PI: 10.5668 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 60.1 | 4.4e-19 | 8 | 68 | 2 | 62 |
XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 ++ +r++r++kNRe+A rsR+RK+a++ eLe+ +++Le+ N++L ke+ee +ke +k ++ 892661 8 AAAQRQKRMIKNRESAARSRERKQAYQVELETLAAKLEEGNEKLLKEIEESTKERYKKLMD 68 5789**************************************************9998776 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.20.5.170 | 1.1E-14 | 5 | 62 | No hit | No description |
SMART | SM00338 | 4.6E-13 | 7 | 71 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 2.9E-18 | 8 | 68 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.634 | 9 | 61 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 2.06E-11 | 11 | 63 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 14 | 29 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 78 aa Download sequence Send to blast |
MTKAMDKAAA QRQKRMIKNR ESAARSRERK QAYQVELETL AAKLEEGNEK LLKEIEESTK 60 ERYKKLMDVL IPFSKRL* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Binds to the G-box motif (5'-CCACGTGG-3') of the rbcS-1A gene promoter. G-box and G-box-like motifs are cis-acting elements defined in promoters of certain plant genes which are regulated by such diverse stimuli as light-induction or hormone control. {ECO:0000269|PubMed:8146148}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 892661 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC003027 | 3e-89 | AC003027.1 Arabidopsis thaliana chromosome I BAC F21M11 genomic sequence, complete sequence. | |||
GenBank | AY087603 | 3e-89 | AY087603.1 Arabidopsis thaliana clone 36980 mRNA, complete sequence. | |||
GenBank | BT024495 | 3e-89 | BT024495.1 Arabidopsis thaliana At1g03970 mRNA, complete cds. | |||
GenBank | CP002684 | 3e-89 | CP002684.1 Arabidopsis thaliana chromosome 1 sequence. | |||
GenBank | U01823 | 3e-89 | U01823.1 Arabidopsis thaliana Columbia bZIP protein GBF4 gene, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002894569.2 | 2e-47 | G-box-binding factor 4 | ||||
Swissprot | P42777 | 8e-38 | GBF4_ARATH; G-box-binding factor 4 | ||||
TrEMBL | D7KNY1 | 8e-46 | D7KNY1_ARALL; Uncharacterized protein | ||||
STRING | scaffold_105455.1 | 1e-46 | (Arabidopsis lyrata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM3852 | 28 | 55 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G03970.1 | 2e-29 | G-box binding factor 4 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 892661 |
Entrez Gene | 9330630 |