PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 889673
Common NameARALYDRAFT_889673, ARALYDRAFT_889675
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NF-YB
Protein Properties Length: 212aa    MW: 23461.2 Da    PI: 4.9271
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
889673genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB172.83.8e-5427122297
   NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
             reqd+++Pianv+rim+k+lP++akis+daket+qecvse+isfvt+ea+++cqre+rkti+++d+lwa+++lGf++yv+pl+v++++yre+e+++
  889673  27 REQDQYMPIANVIRIMRKILPSHAKISDDAKETIQECVSEYISFVTGEANERCQREQRKTITAEDILWAMSKLGFDNYVDPLTVFINRYREIETDR 122
             89*******************************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.103.7E-4820125IPR009072Histone-fold
SuperFamilySSF471135.12E-3729129IPR009072Histone-fold
PfamPF008082.1E-263296IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006152.3E-166078No hitNo description
PROSITE patternPS0068506379IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006152.3E-167997No hitNo description
PRINTSPR006152.3E-1698116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
MDDGAVEIRE EQRRLIVAQQ QPPCMAREQD QYMPIANVIR IMRKILPSHA KISDDAKETI  60
QECVSEYISF VTGEANERCQ REQRKTITAE DILWAMSKLG FDNYVDPLTV FINRYREIET  120
DRGSALRGEP PSLRQAYGGN GIGFHGPPHG PSHGLPPPGP YGYGMLDQSM VMGDGRFYQN  180
GSSGQDESSA GGGYSSSING MPAYDQYGQY K*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5g49_A2e-5626117697NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtComponent of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. Acts as a central regulator of the embryogenesis. Required for the speciation of cotyledon identity and the completion of embryo maturation. Controls seed storage protein genes through the regulation of FUS3 and ABI3. Involved in the blue light (BL) and abscisic acid (ABA) signaling pathways. {ECO:0000269|PubMed:12578989, ECO:0000269|PubMed:15695450, ECO:0000269|PubMed:17322342, ECO:0000269|PubMed:9657152}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap889673
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0134820.0AC013482.2 Genomic sequence for Arabidopsis thaliana BAC T26F17 from chromosome I, complete sequence.
GenBankAF0366840.0AF036684.1 Arabidopsis thaliana CCAAT-box binding factor HAP3 homolog gene, complete cds.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002890476.11e-156nuclear transcription factor Y subunit B-9 isoform X2
RefseqXP_002890478.11e-156nuclear transcription factor Y subunit B-9 isoform X2
RefseqXP_020869803.11e-156nuclear transcription factor Y subunit B-9 isoform X2
RefseqXP_020869805.11e-156nuclear transcription factor Y subunit B-9 isoform X2
SwissprotQ9SFD81e-126NFYB9_ARATH; Nuclear transcription factor Y subunit B-9
TrEMBLD7KKW71e-155D7KKW7_ARALL; Uncharacterized protein
STRINGscaffold_102467.11e-156(Arabidopsis lyrata)
STRINGscaffold_102469.11e-156(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM80422640
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21970.11e-104NF-YB family protein
Publications ? help Back to Top
  1. Yang C, et al.
    VAL- and AtBMI1-mediated H2Aub initiate the switch from embryonic to postgerminative growth in Arabidopsis.
    Curr. Biol., 2013. 23(14): p. 1324-9
    [PMID:23810531]
  2. Guo F, et al.
    Induced expression of AtLEC1 and AtLEC2 differentially promotes somatic embryogenesis in transgenic tobacco plants.
    PLoS ONE, 2013. 8(8): p. e71714
    [PMID:23951228]
  3. Jia H,McCarty DR,Suzuki M
    Distinct roles of LAFL network genes in promoting the embryonic seedling fate in the absence of VAL repression.
    Plant Physiol., 2013. 163(3): p. 1293-305
    [PMID:24043445]
  4. Kim HU, et al.
    Ectopic overexpression of castor bean LEAFY COTYLEDON2 (LEC2) in Arabidopsis triggers the expression of genes that encode regulators of seed maturation and oil body proteins in vegetative tissues.
    FEBS Open Bio, 2013. 4: p. 25-32
    [PMID:24363987]
  5. Garcês HM,Koenig D,Townsley BT,Kim M,Sinha NR
    Truncation of LEAFY COTYLEDON1 protein is required for asexual reproduction in Kalanchoë daigremontiana.
    Plant Physiol., 2014. 165(1): p. 196-206
    [PMID:24664206]
  6. Rikiishi K,Maekawa M
    Seed maturation regulators are related to the control of seed dormancy in wheat (Triticum aestivum L.).
    PLoS ONE, 2014. 9(9): p. e107618
    [PMID:25211528]
  7. Yamamoto A, et al.
    Cell-by-cell developmental transition from embryo to post-germination phase revealed by heterochronic gene expression and ER-body formation in Arabidopsis leafy cotyledon mutants.
    Plant Cell Physiol., 2014. 55(12): p. 2112-25
    [PMID:25282558]
  8. Shen Y,Devic M,Lepiniec L,Zhou DX
    Chromodomain, Helicase and DNA-binding CHD1 protein, CHR5, are involved in establishing active chromatin state of seed maturation genes.
    Plant Biotechnol. J., 2015. 13(6): p. 811-20
    [PMID:25581843]
  9. Yoshii M,Yamamoto A,Kagaya Y,Takeda S,Hattori T
    The Arabidopsis transcription factor NAI1 is required for enhancing the active histone mark but not for removing the repressive mark on PYK10, a seedling-specific gene upon embryonic-to-postgerminative developmental phase transition.
    Plant Signal Behav, 2015. 10(12): p. e1105418
    [PMID:26479492]
  10. Huang M,Hu Y,Liu X,Li Y,Hou X
    Arabidopsis LEAFY COTYLEDON1 Mediates Postembryonic Development via Interacting with PHYTOCHROME-INTERACTING FACTOR4.
    Plant Cell, 2015. 27(11): p. 3099-111
    [PMID:26566918]
  11. Huang M,Hu Y,Liu X,Li Y,Hou X
    Arabidopsis LEAFY COTYLEDON1 controls cell fate determination during post-embryonic development.
    Front Plant Sci, 2015. 6: p. 955
    [PMID:26579186]
  12. Schneider A, et al.
    Potential targets of VIVIPAROUS1/ABI3-LIKE1 (VAL1) repression in developing Arabidopsis thaliana embryos.
    Plant J., 2016. 85(2): p. 305-19
    [PMID:26678037]
  13. Baud S, et al.
    Deciphering the Molecular Mechanisms Underpinning the Transcriptional Control of Gene Expression by Master Transcriptional Regulators in Arabidopsis Seed.
    Plant Physiol., 2016. 171(2): p. 1099-112
    [PMID:27208266]
  14. Fatihi A, et al.
    Deciphering and modifying LAFL transcriptional regulatory network in seed for improving yield and quality of storage compounds.
    Plant Sci., 2016. 250: p. 198-204
    [PMID:27457996]
  15. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]
  16. Han JD, et al.
    Evolutionary Analysis of the LAFL Genes Involved in the Land Plant Seed Maturation Program.
    Front Plant Sci, 2017. 8: p. 439
    [PMID:28421087]
  17. Pelletier JM, et al.
    LEC1 sequentially regulates the transcription of genes involved in diverse developmental processes during seed development.
    Proc. Natl. Acad. Sci. U.S.A., 2017. 114(32): p. E6710-E6719
    [PMID:28739919]
  18. Horstman A, et al.
    The BABY BOOM Transcription Factor Activates the LEC1-ABI3-FUS3-LEC2 Network to Induce Somatic Embryogenesis.
    Plant Physiol., 2017. 175(2): p. 848-857
    [PMID:28830937]
  19. Tao Z, et al.
    Embryonic epigenetic reprogramming by a pioneer transcription factor in plants.
    Nature, 2017. 551(7678): p. 124-128
    [PMID:29072296]
  20. Hanano A,Almousally I,Shaban M,Murphy DJ
    Arabidopsis plants exposed to dioxin result in a WRINKLED seed phenotype due to 20S proteasomal degradation of WRI1.
    J. Exp. Bot., 2018. 69(7): p. 1781-1794
    [PMID:29394403]
  21. Chen N,Veerappan V,Abdelmageed H,Kang M,Allen RD
    HSI2/VAL1 Silences AGL15 to Regulate the Developmental Transition from Seed Maturation to Vegetative Growth in Arabidopsis.
    Plant Cell, 2018. 30(3): p. 600-619
    [PMID:29475938]
  22. Boulard C, et al.
    LEC1 (NF-YB9) directly interacts with LEC2 to control gene expression in seed.
    Biochim Biophys Acta Gene Regul Mech, 2018. 1861(5): p. 443-450
    [PMID:29580949]