PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 886791 | ||||||||
Common Name | ARALYDRAFT_686235 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 233aa MW: 26541.8 Da PI: 9.4407 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 74.1 | 1.1e-23 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienks rqvtf+kRrng++ KA LS+LC+ va+ii+s tg+ly +ss 886791 9 KRIENKSSRQVTFCKRRNGLMEKARQLSILCESSVALIIISATGRLYSFSS 59 79***********************************************96 PP | |||||||
2 | K-box | 28.6 | 5.8e-11 | 145 | 197 | 47 | 99 |
K-box 47 slkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 s+ L++Le+q++++l+ R++K el +e +++lq+kek l een+ L+++l+ 886791 145 SIDCLKSLEEQIKTALSITRARKAELTMEFVKTLQEKEKLLIEENQVLTSQLK 197 6777*********************************************9986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 2.1E-32 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 29.254 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 2.48E-33 | 2 | 78 | No hit | No description |
SuperFamily | SSF55455 | 1.57E-26 | 2 | 78 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.1E-24 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 3.1E-22 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.1E-24 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.1E-24 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 9.219 | 112 | 202 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 1.1E-7 | 141 | 196 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009910 | Biological Process | negative regulation of flower development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0016021 | Cellular Component | integral component of membrane | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 233 aa Download sequence Send to blast |
MGRRKVEIKR IENKSSRQVT FCKRRNGLME KARQLSILCE SSVALIIISA TGRLYSFSSG 60 DSMAKILSRY ELQQADDLKT LCLNIVDKDQ DRDTLFFTAG IALESLRHGS KLVDLEEKNL 120 NYLSHKELLE IIQCKIEETK SDNVSIDCLK SLEEQIKTAL SITRARKAEL TMEFVKTLQE 180 KEKLLIEENQ VLTSQLKKMG KMKKSRETED ARAMSPENSS RNKPPETLLL LK* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 2e-17 | 1 | 70 | 1 | 69 | MEF2C |
5f28_B | 2e-17 | 1 | 70 | 1 | 69 | MEF2C |
5f28_C | 2e-17 | 1 | 70 | 1 | 69 | MEF2C |
5f28_D | 2e-17 | 1 | 70 | 1 | 69 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in the negative regulation of flowering time in short days, probably through the photoperiodic and vernalization pathways. Prevents premature flowering, particularly in the cv. Landsberg erecta background. In non-inductive photoperiods (e.g. short days), required for flowering through VIL2-mediated maintenance of the epigenetically repressed state of MAF5 via H3K9me2 and plant homeodomain / polycomb repressive complex 2 (PHD-PRC2)-dependent H3K27me3. {ECO:0000269|PubMed:12724541, ECO:0000269|PubMed:18798874, ECO:0000269|PubMed:18852898, ECO:0000269|PubMed:20837520, ECO:0000269|PubMed:21150261, ECO:0000269|PubMed:21175890, ECO:0000269|PubMed:21398257, ECO:0000269|PubMed:22378382}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 886791 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Up-regulated by vernalization. Repressed by VIL2, AGL6, CLF, EMF2 and FIE via epigenetic chromatin H3K27me3 and H3K9me2 regulation during the vegetative development. {ECO:0000269|PubMed:12724541}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF214486 | 1e-136 | AF214486.1 Arabidopsis thaliana MADS box protein FCL2 (FCL2) mRNA, partial cds. | |||
GenBank | AY231450 | 1e-136 | AY231450.1 Arabidopsis thaliana MADS affecting flowering 4 variant I (MAF4) mRNA, complete cds. | |||
GenBank | AY231453 | 1e-136 | AY231453.1 Arabidopsis thaliana MADS affecting flowering 4 variant IV (MAF4) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020889324.1 | 1e-164 | protein MADS AFFECTING FLOWERING 5 isoform X2 | ||||
Swissprot | Q683D7 | 1e-83 | MAF5_ARATH; Protein MADS AFFECTING FLOWERING 5 | ||||
TrEMBL | D7MT76 | 1e-165 | D7MT76_ARALL; Predicted protein | ||||
STRING | Al_scaffold_0008_3055 | 1e-166 | (Arabidopsis lyrata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM986 | 19 | 87 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G65070.2 | 1e-145 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | 886791 |
Entrez Gene | 9301013 |