 |
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
85923 |
Common Name | LEAFY, SELMODRAFT_417910 |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
Family |
LFY |
Protein Properties |
Length: 117aa MW: 13943.1 Da PI: 10.0037 |
Description |
LFY family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
85923 | genome | JGI | View CDS |
|
Signature Domain? help Back to Top |
 |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | FLO_LFY | 255.1 | 3e-78 | 1 | 115 | 271 | 385 |
FLO_LFY 271 kerGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarqgwdidavfnahprLsiWYvPt 372
kerGekcPtkvtnqvfr+ak+ gasyinkPkmrhYvhCYalhcLd e+sn+lr+ fk+rgenvGawrqacy+plv++a++ +wdi++vf+++++L+iWYvPt
85923 1 KERGEKCPTKVTNQVFRHAKHRGASYINKPKMRHYVHCYALHCLDLEQSNHLRKVFKDRGENVGAWRQACYYPLVEMARNLNWDIEGVFSRNDKLRIWYVPT 102
89**************************************************************************************************** PP
FLO_LFY 373 kLrqLChlerska 385
+LrqLChle+sk+
85923 103 RLRQLCHLEKSKE 115
**********997 PP
|
Gene Ontology ? help Back to Top |
GO Term |
GO Category |
GO Description |
GO:0006355 | Biological Process | regulation of transcription, DNA-templated |
GO:0010077 | Biological Process | maintenance of inflorescence meristem identity |
GO:0010582 | Biological Process | floral meristem determinacy |
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
GO:0031490 | Molecular Function | chromatin DNA binding |
GO:0042803 | Molecular Function | protein homodimerization activity |
GO:0043565 | Molecular Function | sequence-specific DNA binding |
GO:0043621 | Molecular Function | protein self-association |
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Probable transcription factor. {ECO:0000250}. |
Best hit in Arabidopsis thaliana ? help
Back to Top |
Hit ID |
E-value |
Description |
AT5G61850.1 | 1e-62 | floral meristem identity control protein LEAFY (LFY) |