PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantTFDB

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Protein Features |

Gene Ontology |

Orthologous Group |

Basic Information? help Back to Top

TF ID

77618

Common Name

MICPUN_77618

Organism

Micromonas sp. RCC299

Taxonomic ID

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Mamiellaceae; Micromonas

Family

Protein Properties

Length: 160aa MW: 18528.3 Da PI: 8.4674

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
77618	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	46.7	7.2e-15	8	53	2	48
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 g W Ede+l+ av ++G+++W++I++ + ++++kqck rw+ +l 77618 8 GVWKNTEDEILKAAVMKYGKNQWARISSLLV-RKSAKQCKARWYEWL 53 78***************************.**********986 PP
2	Myb_DNA-binding	32.9	1.5e-10	60	103	2	48
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 WT +Ede+l+++ k++++ W+t+a +g Rt+ qc +r+ k+l 77618 60 TEWTRQEDEKLLHLAKLMPTQ-WRTVAPIVG--RTPAQCLERYEKLL 103 68***************99.****8..********9986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	21.567	1	57	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	4.0E-19	5	56	IPR009057	Homeodomain-like
SMART	SM00717	7.0E-15	6	55	IPR001005	SANT/Myb domain
Pfam	PF13921	9.0E-14	10	70	No hit	No description
CDD	cd00167	6.35E-12	10	53	No hit	No description
SuperFamily	SSF46689	3.82E-21	33	109	IPR009057	Homeodomain-like
CDD	cd11659	1.68E-30	55	106	No hit	No description
Gene3D	G3DSA:1.10.10.60	2.8E-14	57	104	IPR009057	Homeodomain-like
PROSITE profile	PS51294	15.209	58	107	IPR017930	Myb domain
SMART	SM00717	3.7E-11	58	105	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 160 aa Download sequence Send to blast
MRILIKGGVW KNTEDEILKA AVMKYGKNQW ARISSLLVRK SAKQCKARWY EWLDPSIKKT 60 EWTRQEDEKL LHLAKLMPTQ WRTVAPIVGR TPAQCLERYE KLLDAACQQD SNDALDDPRR 120 LKPGEIDPNP ESKPARPDPV DMDEEEKEML SEARARLANT

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5mqf_L	6e-92	2	160	3	162	Cell division cycle 5-like protein
5xjc_L	6e-92	2	160	3	162	Cell division cycle 5-like protein
5yzg_L	6e-92	2	160	3	162	Cell division cycle 5-like protein
5z56_L	6e-92	2	160	3	162	Cell division cycle 5-like protein
5z57_L	6e-92	2	160	3	162	Cell division cycle 5-like protein
5z58_L	6e-92	2	160	3	162	Cell division cycle 5-like protein
6ff4_L	6e-92	2	160	3	162	Cell division cycle 5-like protein
6ff7_L	6e-92	2	160	3	162	Cell division cycle 5-like protein
6icz_L	6e-92	2	160	3	162	Cell division cycle 5-like protein
6id0_L	6e-92	2	160	3	162	Cell division cycle 5-like protein
6id1_L	6e-92	2	160	3	162	Cell division cycle 5-like protein
6qdv_O	6e-92	2	160	3	162	Cell division cycle 5-like protein
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the MAC complex that probably regulates defense responses through transcriptional control and thereby is essential for plant innate immunity. Possesses a sequence specific DNA sequence 'CTCAGCG' binding activity. Involved in mRNA splicing and cell cycle control. May also play a role in the response to DNA damage. {ECO:0000250\|UniProtKB:Q99459, ECO:0000269\|PubMed:17298883, ECO:0000269\|PubMed:17575050, ECO:0000269\|PubMed:8917598}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	CP001574	1e-161	CP001574.1 Micromonas sp. RCC299 chromosome 1, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002507152.1	1e-114	predicted protein, partial
Refseq	XP_002507153.1	1e-111	predicted protein
Swissprot	P92948	1e-102	CDC5L_ARATH; Cell division cycle 5-like protein
TrEMBL	C1FDL9	1e-110	C1FDL9_MICCC; Uncharacterized protein
TrEMBL	C1FDM0	1e-112	C1FDM0_MICCC; Uncharacterized protein (Fragment)
STRING	XP_002507153.1	1e-111	(Micromonas sp. RCC299)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Chlorophytae	OGCP1040	16	17

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G09770.1	1e-104	cell division cycle 5

Link Out ? help Back to Top
Phytozome	77618
Entrez Gene	8250085

Publications ? help Back to Top
Worden AZ, et al. Green evolution and dynamic adaptations revealed by genomes of the marine picoeukaryotes Micromonas. Science, 2009. 324(5924): p. 268-72 [PMID:19359590] Heyndrickx KS,Vandepoele K Systematic identification of functional plant modules through the integration of complementary data sources. Plant Physiol., 2012. 159(3): p. 884-901 [PMID:22589469] Li S, et al. MAC3A and MAC3B, Two Core Subunits of the MOS4-Associated Complex, Positively Influence miRNA Biogenesis. Plant Cell, 2018. 30(2): p. 481-494 [PMID:29437988]