PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella

Family

NF-YC

Protein Properties

Length: 95aa MW: 10892.7 Da PI: 7.5244

Description

NF-YC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
77573	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YC	155.6	8.7e-49	1	88	15	102
NF-YC 15 dfknhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprdelk 102 dfk h+lPlarikki+kadedvkmisaeaPvl++kacelfilelt+r+w+h+eenkrrtl+++d+a a++r+difdflvdivpr+elk 77573 1 DFKTHQLPLARIKKIMKADEDVKMISAEAPVLFAKACELFILELTFRAWMHTEENKRRTLQRNDVAGAISRADIFDFLVDIVPREELK 88 8***********************************************************************************9875 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF47113	2.68E-30	1	78	IPR009072	Histone-fold
Pfam	PF00808	7.7E-22	6	69	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
Gene3D	G3DSA:1.10.20.10	6.7E-38	7	84	IPR009072	Histone-fold

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 95 aa Download sequence Send to blast
DFKTHQLPLA RIKKIMKADE DVKMISAEAP VLFAKACELF ILELTFRAWM HTEENKRRTL 60 QRNDVAGAIS RADIFDFLVD IVPREELKVT FLST*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5g49_B	9e-49	1	84	12	95	NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT C-3
Search in ModeBase

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	56	62	RRTLQRN

Functional Description ? help Back to Top
Source	Description
UniProt	Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters (By similarity). Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000250, ECO:0000269\|PubMed:17322342}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002961501.2	2e-59	nuclear transcription factor Y subunit C-2
Swissprot	Q9FMV5	4e-52	NFYC4_ARATH; Nuclear transcription factor Y subunit C-4
TrEMBL	D8QRD2	1e-61	D8QRD2_SELML; Uncharacterized protein (Fragment)
STRING	EFJ36761	2e-62	(Selaginella moellendorffii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP315	17	117

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G63470.2	2e-54	nuclear factor Y, subunit C4

Link Out ? help Back to Top
Phytozome	77573
Entrez Gene	9630115

Publications ? help Back to Top
Banks JA, et al. The Selaginella genome identifies genetic changes associated with the evolution of vascular plants. Science, 2011. 332(6032): p. 960-3 [PMID:21551031] Hwang YH, et al. Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time. Plant Cell Rep., 2016. 35(4): p. 857-65 [PMID:26754793] Liu X, et al. The NF-YC-RGL2 module integrates GA and ABA signalling to regulate seed germination in Arabidopsis. Nat Commun, 2016. 7: p. 12768 [PMID:27624486] Myers ZA, et al. NUCLEAR FACTOR Y, Subunit C (NF-YC) Transcription Factors Are Positive Regulators of Photomorphogenesis in Arabidopsis thaliana. PLoS Genet., 2016. 12(9): p. e1006333 [PMID:27685091] Tang Y, et al. Arabidopsis NF-YCs Mediate the Light-Controlled Hypocotyl Elongation via Modulating Histone Acetylation. Mol Plant, 2017. 10(2): p. 260-273 [PMID:27876642] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722] Qi M, et al. QQS orphan gene and its interactor NF-YC4 reduce susceptibility to pathogens and pests. Plant Biotechnol. J., 2019. 17(1): p. 252-263 [PMID:29878511]