![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 72632 | ||||||||
Common Name | FLP-2, SELMODRAFT_86508 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 96aa MW: 11576.4 Da PI: 10.817 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 46 | 1.2e-14 | 1 | 41 | 7 | 48 |
HHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 7 eEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +Ede l ++vk++G++ W+ I+++m+ ++t+ +c+ rw++yl 72632 1 QEDEMLRELVKRHGTKKWHIISAKMQ-NKTPRECRRRWRTYL 41 6*************************.*************97 PP | |||||||
2 | Myb_DNA-binding | 53.6 | 5.3e-17 | 47 | 89 | 1 | 45 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 + +W++eEd l+++++ +G++ W+ Ia++++ gRt++ +k+r++ 72632 47 KSSWSAEEDRMLLEGHNAYGNR-WTEIAKMVP-GRTDNAVKNRFN 89 578*******************.*********.**********98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF00249 | 1.8E-13 | 1 | 41 | IPR001005 | SANT/Myb domain |
SMART | SM00717 | 1.8E-8 | 1 | 43 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 20.634 | 1 | 45 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 5.14E-28 | 1 | 88 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 4.1E-14 | 1 | 46 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 6.77E-11 | 1 | 41 | No hit | No description |
SMART | SM00717 | 1.5E-17 | 46 | 94 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 18.502 | 46 | 96 | IPR017930 | Myb domain |
Pfam | PF00249 | 4.3E-16 | 47 | 89 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.0E-20 | 47 | 95 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.86E-11 | 49 | 91 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009553 | Biological Process | embryo sac development | ||||
GO:0010052 | Biological Process | guard cell differentiation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 96 aa Download sequence Send to blast |
QEDEMLRELV KRHGTKKWHI ISAKMQNKTP RECRRRWRTY LHMCMNKSSW SAEEDRMLLE 60 GHNAYGNRWT EIAKMVPGRT DNAVKNRFNA LCKKRS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 5e-31 | 1 | 95 | 13 | 107 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds to DNA in promoters cis-regulatory element 5'-GGCGCGC-3' of cell cycle genes, including cyclins, cyclin-dependent kinases (CDKs), and components of the pre-replication complex (PubMed:20675570, PubMed:24687979). Binds to DNA in promoters cis-regulatory element 5'-AGCCG-3' of auxin regulated genes (e.g. PIN3 and PIN7) (PubMed:26578169). Together with FAMA and MYB88, ensures that stomata contain just two guard cells (GCs) by enforcing a single symmetric precursor cell division before stomatal maturity (PubMed:24571519). Represses the expression of the mitosis-inducing factors CDKB1-1 and CDKA-1, specifically required for the last guard mother cells (GMC) symmetric divisions in the stomatal pathway (PubMed:20675570, PubMed:24687979). Represses CYCA2-3 in newly formed guard cells (PubMed:21772250). Together with MYB88, regulates stomata spacing by restricting divisions late in the stomatal cell lineage thus limiting the number of GMC divisions (PubMed:11536724, PubMed:9684356, PubMed:16155180, PubMed:24123248). In collaboration with CDKB1-1 and CDKB1-2, restrict the G1/S transition and chloroplast and nuclear number during stomatal formation, and normally maintain fate and developmental progression throughout the stomatal cell lineage (PubMed:24123248). Also involved in the shape regulation of pavement cells (PubMed:9684356). Involved in sensing and/or transducing abiotic stress (e.g. drought and salt), probably via the positive regulation of NAC019 (PubMed:21105921). Regulates female reproduction being required for entry into megasporogenesis, probably via the regulation of cell cycle genes (PubMed:22915737). Promotes histone H3K27me3 marks and represses stem cell gene expression (PubMed:24654956). Required for lateral roots (LRs) initiation via the regulation of PIN3 expression in an auxin-dependent manner (PubMed:26578065). Involved in responses to gravity stimulation in primary roots by regulating the transcription of PIN3 and PIN7 in gravity-sensing cells, thus modulating auxin asymmetric redistribution (PubMed:26578169). {ECO:0000269|PubMed:11536724, ECO:0000269|PubMed:16155180, ECO:0000269|PubMed:20675570, ECO:0000269|PubMed:21105921, ECO:0000269|PubMed:21772250, ECO:0000269|PubMed:22915737, ECO:0000269|PubMed:24123248, ECO:0000269|PubMed:24571519, ECO:0000269|PubMed:24654956, ECO:0000269|PubMed:24687979, ECO:0000269|PubMed:26578065, ECO:0000269|PubMed:26578169, ECO:0000269|PubMed:9684356}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Strongly induced by auxin in a IAA14/SLR1 and ARF7 dependent manner, especially in xylem pole pericycle cells, lateral roots initiating cells. {ECO:0000269|PubMed:26578065}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024400443.1 | 4e-59 | transcription factor MYB3R-5-like isoform X1 | ||||
Refseq | XP_024400445.1 | 2e-59 | transcription factor MYB3R-5-like isoform X3 | ||||
Refseq | XP_024400446.1 | 2e-59 | transcription factor MYB3R-5-like isoform X3 | ||||
Swissprot | Q94FL6 | 2e-34 | MY124_ARATH; Transcription factor MYB124 | ||||
TrEMBL | D8R7W8 | 9e-66 | D8R7W8_SELML; Uncharacterized protein FLP-2 (Fragment) | ||||
STRING | EFJ31953 | 2e-66 | (Selaginella moellendorffii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G14350.2 | 9e-37 | MYB family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | 72632 |
Entrez Gene | 9632071 |