 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
69510 |
| Common Name | HANb-1, HANb-2, SELMODRAFT_107936, SELMODRAFT_451362 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
| Family |
GATA |
| Protein Properties |
Length: 59aa MW: 6125.87 Da PI: 10.0217 |
| Description |
GATA family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| 69510 | genome | JGI | View CDS |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | GATA | 61.7 | 9.1e-20 | 16 | 50 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
C++Cg+tkTplWR+gp g+k+LCnaCG++y+k g+
69510 16 CTQCGATKTPLWRNGPCGPKSLCNACGIRYKKVGS 50
********************************875 PP
|
| Gene Ontology ? help Back to Top |
| GO Term |
GO Category |
GO Description |
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated |
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
| GO:0008270 | Molecular Function | zinc ion binding |
| GO:0043565 | Molecular Function | sequence-specific DNA binding |
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Probable transcription factor that regulates organogenesis during transition from the vegetative to the reproductive phase. Regulates the expression of CYP78A11/PLA1, HD3A and MADS1 during reproductive development in rice. May act upstream of CYP78A11/PLA1 during panicle development. Acts independently of the photoperiodic and gibberellin signaling pathways. {ECO:0000269|PubMed:19337211}. |
| UniProt | Transcriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. {ECO:0000250}. |
| UniProt | Transcriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. {ECO:0000250}. |
| UniProt | Transcriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. Regulates both flower and shoot apical meristem (SAM) development, especially for establishing organ boundaries in shoots and flowers, probably by controlling the number and position of WUS-expressing cells (PubMed:23335616, PubMed:25077795). {ECO:0000250, ECO:0000269|PubMed:23335616, ECO:0000269|PubMed:25077795}. |
| Regulation -- Description ? help
Back to Top |
| Source |
Description |
| UniProt | INDUCTION: Repressed by HAN. {ECO:0000269|PubMed:23335616}. |
| Orthologous Group
? help Back to Top |
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Representative plant | OGRP68 | 17 | 287 |
| Publications
? help Back to Top |
- Kikuchi S, et al.
Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
Science, 2003. 301(5631): p. 376-9
[PMID:12869764] - Cheng CH, et al.
A fine physical map of the rice chromosome 5.
Mol. Genet. Genomics, 2005. 274(4): p. 337-45
[PMID:16261349] - Banks JA, et al.
The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
Science, 2011. 332(6032): p. 960-3
[PMID:21551031] - Ding Y, et al.
Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
BMC Plant Biol., 2013. 13: p. 229
[PMID:24377444] - Behringer C,Bastakis E,Ranftl QL,Mayer KF,Schwechheimer C
Functional diversification within the family of B-GATA transcription factors through the leucine-leucine-methionine domain.
Plant Physiol., 2014. 166(1): p. 293-305
[PMID:25077795] - Ranftl QL,Bastakis E,Klermund C,Schwechheimer C
LLM-Domain Containing B-GATA Factors Control Different Aspects of Cytokinin-Regulated Development in Arabidopsis thaliana.
Plant Physiol., 2016. 170(4): p. 2295-311
[PMID:26829982]
|
