PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella

Family

NAC

Protein Properties

Length: 129aa MW: 15159 Da PI: 9.5464

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
68150	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	180.7	3.7e-56	1	125	2	128
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkkt 105 ppGfrF+Ptd+elv +yL++kv+g+++++ ++i+evd+yk+ePwdLp k + ++ ewyfFs+rd+ky++g r+nrat++gyWkatgkd++v s +++++g+kkt 68150 1 PPGFRFRPTDQELVGFYLARKVSGRSIQA-NIIAEVDLYKCEPWDLPGKSYVTDVEWYFFSPRDRKYPNGWRTNRATEAGYWKATGKDRTVRS-GSRDIGMKKT 102 89*************************.89***********87788899*********************************9.99**** PP NAM 106 LvfykgrapkgektdWvmheyrl 128 Lvfy+grap+g++tdW+mheyrl 68150 103 LVFYTGRAPHGQRTDWIMHEYRL 125 *******************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51005	56.074	1	129	IPR003441	NAC domain
Pfam	PF02365	3.5E-30	1	125	IPR003441	NAC domain
SuperFamily	SSF101941	2.35E-59	1	128	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 129 aa Download sequence Send to blast
PPGFRFRPTD QELVGFYLAR KVSGRSIQAN IIAEVDLYKC EPWDLPGKSY VTDVEWYFFS 60 PRDRKYPNGW RTNRATEAGY WKATGKDRTV RSGSRDIGMK KTLVFYTGRA PHGQRTDWIM 120 HEYRLDEDD

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3ulx_A	1e-53	1	125	16	140	Stress-induced transcription factor NAC1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC045, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269\|PubMed:25081480}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00212	DAP	Transfer from AT1G65910	Download

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	-	Retrieve

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002980786.2	1e-91	NAC domain-containing protein 74 isoform X1
Swissprot	Q9FFI5	3e-64	NAC86_ARATH; NAC domain-containing protein 86
TrEMBL	D8QTJ0	2e-91	D8QTJ0_SELML; Uncharacterized protein (Fragment)
STRING	EFJ17971	4e-92	(Selaginella moellendorffii)
STRING	EFJ37124	4e-92	(Selaginella moellendorffii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP17	15	800

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G65910.1	2e-70	NAC domain containing protein 28

Link Out ? help Back to Top
Phytozome	68150
Entrez Gene	9629662 \| 9656960

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Banks JA, et al. The Selaginella genome identifies genetic changes associated with the evolution of vascular plants. Science, 2011. 332(6032): p. 960-3 [PMID:21551031]