![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 678466617 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 115aa MW: 13173.5 Da PI: 7.3657 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 131.9 | 2.1e-41 | 37 | 112 | 2 | 77 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 Cqv++C+a+l++ak yhrrhkvCe+h+ka++vl++g +qrfCqqCsrfhelsefD++krsCrrrLa+hnerrrk++ 678466617 37 CQVDDCTANLTSAKLYHRRHKVCEFHAKAAAVLLQGSQQRFCQQCSRFHELSEFDDSKRSCRRRLAGHNERRRKST 112 **************************************************************************87 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.1100.10 | 2.1E-34 | 30 | 98 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 31.693 | 34 | 111 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 3.66E-37 | 36 | 114 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 2.1E-33 | 37 | 110 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010321 | Biological Process | regulation of vegetative phase change | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 115 aa Download sequence Send to blast |
MERDKYCETG DEDEAAEDEE SSWVAASKPG SSQPRSCQVD DCTANLTSAK LYHRRHKVCE 60 FHAKAAAVLL QGSQQRFCQQ CSRFHELSEF DDSKRSCRRR LAGHNERRRK STCDS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 1e-39 | 29 | 110 | 3 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 678466617 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009622641.1 | 1e-42 | PREDICTED: squamosa promoter-binding protein 1 | ||||
Refseq | XP_011096328.1 | 9e-43 | squamosa promoter-binding protein 1 | ||||
Refseq | XP_016433751.1 | 1e-42 | PREDICTED: squamosa promoter-binding protein 1-like | ||||
Swissprot | Q38741 | 6e-43 | SBP1_ANTMA; Squamosa promoter-binding protein 1 | ||||
TrEMBL | A0A2G9GQ12 | 1e-43 | A0A2G9GQ12_9LAMI; Squamosa promoter-binding-like protein | ||||
STRING | XP_009622640.1 | 4e-42 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA749 | 24 | 105 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G53160.2 | 1e-41 | squamosa promoter binding protein-like 4 |
Publications ? help Back to Top | |||
---|---|---|---|
|