![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 678392400 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 153aa MW: 16872.5 Da PI: 10.0085 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 94.5 | 1.3e-29 | 18 | 74 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 dep+YVNaKQy++Il+RR++Rak e++ kl k kpylheSRh+hA+ R Rg gGrF 678392400 18 DEPIYVNAKQYHGILRRRESRAKHEARCKL-VKRAKPYLHESRHRHAISRVRGAGGRF 74 79****************************.9*************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 4.3E-31 | 16 | 77 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 32.056 | 17 | 77 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 1.9E-25 | 19 | 74 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 1.9E-22 | 20 | 42 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 1.9E-22 | 51 | 74 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 153 aa Download sequence Send to blast |
MMGAPCGRIP LPAKLLDDEP IYVNAKQYHG ILRRRESRAK HEARCKLVKR AKPYLHESRH 60 RHAISRVRGA GGRFISTKKQ QTPPTEQQPP LNSYCSIVPV AEHQLTVNVE LPLQDAGNGL 120 IDNGKVIHAS SVPGEMPCHP CSSSLALSNV KCN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 2e-22 | 18 | 83 | 2 | 67 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters (By similarity). Involved in the blue light (BL) and abscisic acid (ABA) signaling pathways. {ECO:0000250, ECO:0000269|PubMed:17322342}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 678392400 |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020553571.1 | 5e-37 | nuclear transcription factor Y subunit A-3 isoform X3 | ||||
Refseq | XP_020553572.1 | 5e-37 | nuclear transcription factor Y subunit A-3 isoform X5 | ||||
Refseq | XP_020553573.1 | 5e-37 | nuclear transcription factor Y subunit A-3 isoform X5 | ||||
Swissprot | Q9SYH4 | 8e-30 | NFYA5_ARATH; Nuclear transcription factor Y subunit A-5 | ||||
TrEMBL | A0A2G9HRD3 | 1e-34 | A0A2G9HRD3_9LAMI; CCAAT-binding factor, subunit B (HAP2) | ||||
STRING | XP_010666451.1 | 4e-34 | (Beta vulgaris) | ||||
STRING | POPTR_0006s14740.1 | 7e-34 | (Populus trichocarpa) | ||||
STRING | Migut.J00955.1.p | 9e-35 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA5009 | 23 | 38 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G54160.1 | 2e-29 | nuclear factor Y, subunit A5 |