PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia

Family

ZF-HD

Protein Properties

Length: 88aa MW: 9636.8 Da PI: 8.1225

Description

ZF-HD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
678310291	genome	UGSP	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	ZF-HD_dimer	104	9.8e-33	24	78	3	58
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 +vrY eC+kNhAas+Gg+avDGC+Efmp g++gta+al CaAC CHRnFHRreve 678310291 24 SVRYAECQKNHAASIGGYAVDGCREFMPG-GADGTAEALSCAACTCHRNFHRREVE 78 79************************9.999******************987 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF04770	1.6E-30	25	77	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMs	TIGR01566	1.7E-27	26	77	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profile	PS51523	25.503	27	76	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDom	PD125774	4.0E-21	27	86	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain

Sequence ? help Back to Top
Protein Sequence Length: 88 aa Download sequence Send to blast
MNKKQIVIRR EGYMRSSSAG VSRSVRYAEC QKNHAASIGG YAVDGCREFM PGGADGTAEA 60 LSCAACTCHR NFHRREVELD VVCDNSYS

Functional Description ? help Back to Top
Source	Description
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269\|PubMed:21455630}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	678310291

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_028108012.1	9e-40	mini zinc finger protein 2-like
Swissprot	Q9LJW5	5e-30	MIF2_ARATH; Mini zinc finger protein 2
TrEMBL	S8EAP2	8e-40	S8EAP2_9LAMI; Uncharacterized protein
STRING	XP_010037168.1	1e-36	(Eucalyptus grandis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA1105	24	86

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G74660.1	7e-30	mini zinc finger 1

Publications ? help Back to Top
Bollier N, et al. At-MINI ZINC FINGER2 and Sl-INHIBITOR OF MERISTEM ACTIVITY, a Conserved Missing Link in the Regulation of Floral Meristem Termination in Arabidopsis and Tomato. Plant Cell, 2018. 30(1): p. 83-100 [PMID:29298836]