![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 676759728 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 121aa MW: 13707 Da PI: 9.1045 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 126.3 | 1.4e-39 | 5 | 104 | 1 | 100 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100 +CaaCk+lrr+C+kdC+++pyfp ++p+kfa++h+++Ga nv+k+l++lp ++r +a++sl +eA++r++dPvyG+vg++ lq q++++++ la++++e 676759728 5 RCAACKYLRRRCPKDCIFSPYFPPNDPAKFACIHRIYGAGNVSKMLQQLPVQTRAEAVESLSFEAKCRVEDPVYGCVGIVYLLQTQIQKTQNLLAKTQAE 104 6********************************************************************************************9999987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 23.65 | 4 | 105 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 9.5E-39 | 5 | 102 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 121 aa Download sequence Send to blast |
MNPKRCAACK YLRRRCPKDC IFSPYFPPND PAKFACIHRI YGAGNVSKML QQLPVQTRAE 60 AVESLSFEAK CRVEDPVYGC VGIVYLLQTQ IQKTQNLLAK TQAEIAVVQT KHSHTQISEF 120 M |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 9e-37 | 6 | 105 | 12 | 111 | LOB family transfactor Ramosa2.1 |
5ly0_B | 9e-37 | 6 | 105 | 12 | 111 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00381 | DAP | Transfer from AT3G26620 | Download |
![]() |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 676759728 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB473847 | 1e-125 | AB473847.1 Arabidopsis thaliana ASL14 mRNA for ASYMMETRIC LEAVES2-like 14 protein, complete cds. | |||
GenBank | DQ056609 | 1e-125 | DQ056609.1 Arabidopsis thaliana putative LOB domain protein (At3g26620) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018483059.1 | 1e-79 | PREDICTED: LOB domain-containing protein 23 | ||||
Swissprot | P59467 | 5e-77 | LBD23_ARATH; LOB domain-containing protein 23 | ||||
TrEMBL | A0A078FKY4 | 2e-77 | A0A078FKY4_BRANA; BnaA06g32760D protein | ||||
TrEMBL | A0A291LR06 | 2e-77 | A0A291LR06_BRARR; Transcription factor LBD24 | ||||
TrEMBL | A0A397ZCU9 | 2e-77 | A0A397ZCU9_BRACM; Uncharacterized protein | ||||
STRING | Bostr.0556s0333.1.p | 2e-76 | (Boechera stricta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM131 | 28 | 340 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G26620.1 | 2e-79 | LOB domain-containing protein 23 |