![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 676742362 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 87aa MW: 9747.14 Da PI: 9.9135 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 100.7 | 5.4e-32 | 24 | 74 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva++ifs++g+lyey++
676742362 24 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVIFSTRGRLYEYAN 74
79***********************************************85 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 9.1E-40 | 16 | 75 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 33.389 | 16 | 76 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 1.20E-39 | 17 | 79 | No hit | No description |
| SuperFamily | SSF55455 | 1.57E-30 | 17 | 78 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.4E-33 | 18 | 38 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 18 | 72 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 3.8E-27 | 25 | 72 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.4E-33 | 38 | 53 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.4E-33 | 53 | 74 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 87 aa Download sequence Send to blast |
MEGGASNEVA ESSKKIGRGK IEIKRIENTT NRQVTFCKRR NGLLKKAYEL SVLCDAEVAL 60 VIFSTRGRLY EYANNSFSEP QFSVGKL |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1tqe_P | 2e-21 | 16 | 81 | 1 | 76 | Myocyte-specific enhancer factor 2B |
| 1tqe_Q | 2e-21 | 16 | 81 | 1 | 76 | Myocyte-specific enhancer factor 2B |
| 1tqe_R | 2e-21 | 16 | 81 | 1 | 76 | Myocyte-specific enhancer factor 2B |
| 1tqe_S | 2e-21 | 16 | 81 | 1 | 76 | Myocyte-specific enhancer factor 2B |
| 6c9l_A | 2e-21 | 16 | 81 | 1 | 76 | Myocyte-specific enhancer factor 2B |
| 6c9l_B | 2e-21 | 16 | 81 | 1 | 76 | Myocyte-specific enhancer factor 2B |
| 6c9l_C | 2e-21 | 16 | 81 | 1 | 76 | Myocyte-specific enhancer factor 2B |
| 6c9l_D | 2e-21 | 16 | 81 | 1 | 76 | Myocyte-specific enhancer factor 2B |
| 6c9l_E | 2e-21 | 16 | 81 | 1 | 76 | Myocyte-specific enhancer factor 2B |
| 6c9l_F | 2e-21 | 16 | 81 | 1 | 76 | Myocyte-specific enhancer factor 2B |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. Interacts genetically with TT16/AGL32 in a partially antagonistic manner during flower development. Is essential for the coordination of cell divisions in ovule, seed coat development and endosperm formation (PubMed:27776173). {ECO:0000269|PubMed:27776173}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 676742362 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC006931 | 1e-109 | AC006931.6 Arabidopsis thaliana chromosome 2 clone F7D19 map m551, complete sequence. | |||
| GenBank | AY727652 | 1e-109 | AY727652.1 Arabidopsis thaliana ecotype Li-3 SHATTERPROOF2 (SHP2) gene, complete cds. | |||
| GenBank | AY727653 | 1e-109 | AY727653.1 Arabidopsis thaliana ecotype Lu-1 SHATTERPROOF2 (SHP2) gene, complete cds. | |||
| GenBank | AY727654 | 1e-109 | AY727654.1 Arabidopsis thaliana ecotype Mt-0 SHATTERPROOF2 (SHP2) gene, complete cds. | |||
| GenBank | AY727655 | 1e-109 | AY727655.1 Arabidopsis thaliana ecotype PLA-0 SHATTERPROOF2 (SHP2) gene, complete cds. | |||
| GenBank | AY727656 | 1e-109 | AY727656.1 Arabidopsis thaliana ecotype Pog-0 SHATTERPROOF2 (SHP2) gene, complete cds. | |||
| GenBank | AY727657 | 1e-109 | AY727657.1 Arabidopsis thaliana ecotype Tsu-1 SHATTERPROOF2 (SHP2) gene, complete cds. | |||
| GenBank | AY727658 | 1e-109 | AY727658.1 Arabidopsis thaliana ecotype PHW-1 SHATTERPROOF2 (SHP2) gene, complete cds. | |||
| GenBank | AY727659 | 1e-109 | AY727659.1 Arabidopsis thaliana ecotype PHW-33 SHATTERPROOF2 (SHP2) gene, complete cds. | |||
| GenBank | AY727661 | 1e-109 | AY727661.1 Arabidopsis thaliana ecotype An-2 SHATTERPROOF2 (SHP2) gene, complete cds. | |||
| GenBank | AY727662 | 1e-109 | AY727662.1 Arabidopsis thaliana ecotype Br-0 SHATTERPROOF2 (SHP2) gene, complete cds. | |||
| GenBank | AY727663 | 1e-109 | AY727663.1 Arabidopsis thaliana ecotype Cha-0 SHATTERPROOF2 (SHP2) gene, complete cds. | |||
| GenBank | AY727664 | 1e-109 | AY727664.1 Arabidopsis thaliana ecotype Di-0 SHATTERPROOF2 (SHP2) gene, complete cds. | |||
| GenBank | AY727665 | 1e-109 | AY727665.1 Arabidopsis thaliana ecotype Est-1 SHATTERPROOF2 (SHP2) gene, complete cds. | |||
| GenBank | AY727666 | 1e-109 | AY727666.1 Arabidopsis thaliana ecotype Kl-5 SHATTERPROOF2 (SHP2) gene, complete cds. | |||
| GenBank | AY727667 | 1e-109 | AY727667.1 Arabidopsis thaliana ecotype Ko-2 SHATTERPROOF2 (SHP2) gene, complete cds. | |||
| GenBank | AY727668 | 1e-109 | AY727668.1 Arabidopsis thaliana ecotype Lip-0 SHATTERPROOF2 (SHP2) gene, complete cds. | |||
| GenBank | AY727669 | 1e-109 | AY727669.1 Arabidopsis thaliana ecotype 9481B SHATTERPROOF2 (SHP2) gene, complete cds. | |||
| GenBank | BT029453 | 1e-109 | BT029453.1 Arabidopsis thaliana At2g42830 mRNA, complete cds. | |||
| GenBank | CP002685 | 1e-109 | CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_024016862.1 | 1e-47 | agamous-like MADS-box protein AGL5 isoform X2 | ||||
| Swissprot | P29385 | 2e-48 | AGL5_ARATH; Agamous-like MADS-box protein AGL5 | ||||
| TrEMBL | A0A178VRQ3 | 6e-47 | A0A178VRQ3_ARATH; Uncharacterized protein | ||||
| TrEMBL | A0A178VTG2 | 7e-47 | A0A178VTG2_ARATH; Uncharacterized protein | ||||
| TrEMBL | A0A1J3GA74 | 5e-46 | A0A1J3GA74_NOCCA; Agamous-like MADS-box protein AGL5 | ||||
| TrEMBL | V4LR27 | 3e-46 | V4LR27_EUTSA; Uncharacterized protein | ||||
| STRING | Bostr.25993s0500.1.p | 7e-47 | (Boechera stricta) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM78 | 28 | 413 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G42830.2 | 4e-38 | MIKC_MADS family protein | ||||




