PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium

Family

SBP

Protein Properties

Length: 179aa MW: 20597.1 Da PI: 10.1743

Description

SBP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
676740106	genome	VEGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SBP	133.5	6.8e-42	60	134	2	76
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 Cqv++C++dl+eak+yhrrhkvCevh+ka++v++ g++qrfCqqCsrfhel efDe+krsCrrrLa+hnerrrk+ 676740106 60 CQVDRCTTDLKEAKQYHRRHKVCEVHAKASSVYLLGVKQRFCQQCSRFHELLEFDEAKRSCRRRLAGHNERRRKS 134 *************************************************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PIRSF	PIRSF037575	4.5E-58	1	147	IPR017238	Squamosa promoter-binding protein
Gene3D	G3DSA:4.10.1100.10	2.0E-32	53	121	IPR004333	Transcription factor, SBP-box
PROSITE profile	PS51141	31.761	57	134	IPR004333	Transcription factor, SBP-box
SuperFamily	SSF103612	6.15E-38	59	138	IPR004333	Transcription factor, SBP-box
Pfam	PF03110	1.2E-31	60	133	IPR004333	Transcription factor, SBP-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009908	Biological Process	flower development
GO:0010321	Biological Process	regulation of vegetative phase change
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 179 aa Download sequence Send to blast
MEGRKTQGQG YLKKKASMSY LVEEDLENDT DGEEEEKRKG VTDRFKGSSG SSDRGSSRLC 60 QVDRCTTDLK EAKQYHRRHK VCEVHAKASS VYLLGVKQRF CQQCSRFHEL LEFDEAKRSC 120 RRRLAGHNER RRKSPGESFG EGSGGRRGIT SQVMQNQERS RVEMTLPMSN TSFKRPQIR

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ul4_A	5e-45	47	133	1	84	squamosa promoter binding protein-like 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Promotes both vegetative phase change and flowering. {ECO:0000269\|PubMed:10524240, ECO:0000269\|PubMed:16914499}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	676740106

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Negatively regulated by microRNAs miR156 and miR157. {ECO:0000305\|PubMed:12202040, ECO:0000305\|PubMed:16914499}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_013590498.1	1e-111	PREDICTED: squamosa promoter-binding-like protein 4
Swissprot	Q9S7A9	2e-80	SPL4_ARATH; Squamosa promoter-binding-like protein 4
TrEMBL	A0A397YVS3	1e-116	A0A397YVS3_BRACM; Squamosa promoter-binding-like protein
STRING	Bo6g031220.1	1e-111	(Brassica oleracea)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM868	28	118

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G53160.2	2e-69	squamosa promoter binding protein-like 4

Publications ? help Back to Top
Jorgensen SA,Preston JC Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis. Mol. Phylogenet. Evol., 2014. 73: p. 129-39 [PMID:24508602] Hyun Y, et al. Site-directed mutagenesis in Arabidopsis thaliana using dividing tissue-targeted RGEN of the CRISPR/Cas system to generate heritable null alleles. Planta, 2015. 241(1): p. 271-84 [PMID:25269397] Xu M, et al. Developmental Functions of miR156-Regulated SQUAMOSA PROMOTER BINDING PROTEIN-LIKE (SPL) Genes in Arabidopsis thaliana. PLoS Genet., 2016. 12(8): p. e1006263 [PMID:27541584] Ioannidi E, et al. Trichome patterning control involves TTG1 interaction with SPL transcription factors. Plant Mol. Biol., 2016. 92(6): p. 675-687 [PMID:27631431] Jung JH,Lee HJ,Ryu JY,Park CM SPL3/4/5 Integrate Developmental Aging and Photoperiodic Signals into the FT-FD Module in Arabidopsis Flowering. Mol Plant, 2016. 9(12): p. 1647-1659 [PMID:27815142]