![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 676738800 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 134aa MW: 15652.6 Da PI: 7.5112 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 40.7 | 5.3e-13 | 41 | 101 | 3 | 63 |
XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 + ++ rrk +NRe+ArrsR RKk+ + eL + L +eNk L +e+++ + ++++ e+ 676738800 41 DEQKRRRKVSNRESARRSRMRKKQHLNELWSMLAHLVNENKCLVDEVSRAYEAYENVIEEN 101 56789********************************************999999876665 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.20.5.170 | 4.2E-11 | 33 | 92 | No hit | No description |
SMART | SM00338 | 7.6E-13 | 39 | 103 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.622 | 41 | 104 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 5.9E-10 | 43 | 100 | IPR004827 | Basic-leucine zipper domain |
CDD | cd14702 | 2.34E-15 | 44 | 94 | No hit | No description |
SuperFamily | SSF57959 | 3.88E-11 | 44 | 94 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 46 | 61 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0042803 | Molecular Function | protein homodimerization activity | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 134 aa Download sequence Send to blast |
MDGFVYNLQC ANPNPQFLDN LVPRVNLSST SDESSRSAED DEQKRRRKVS NRESARRSRM 60 RKKQHLNELW SMLAHLVNEN KCLVDEVSRA YEAYENVIEE NKKLQEETSK SRKMIGEIGL 120 HRFLNVEGDQ ILTI |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 676738800 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_177054.1 | 3e-59 | basic leucine-zipper 8 | ||||
Swissprot | Q9CA46 | 3e-60 | BZIP8_ARATH; Basic leucine zipper 8 | ||||
TrEMBL | A0A0D3AP40 | 2e-57 | A0A0D3AP40_BRAOL; Uncharacterized protein | ||||
TrEMBL | A0A3N6T191 | 2e-57 | A0A3N6T191_BRACR; Uncharacterized protein | ||||
STRING | AT1G68880.1 | 1e-58 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM15035 | 16 | 19 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G68880.1 | 1e-52 | basic leucine-zipper 8 |
Publications ? help Back to Top | |||
---|---|---|---|
|