![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 57477 | ||||||||
Common Name | SELMODRAFT_57477 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
||||||||
Family | G2-like | ||||||||
Protein Properties | Length: 133aa MW: 15436 Da PI: 10.1946 | ||||||||
Description | G2-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | G2-like | 109.2 | 2.1e-34 | 1 | 55 | 1 | 55 |
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 k+rlrWt+eLH+rFveav+qLGG+++AtPk +l++m+v+gLt++hvkSHLQkYRl 57477 1 KQRLRWTSELHDRFVEAVTQLGGPDRATPKGVLRIMGVHGLTIYHVKSHLQKYRL 55 79****************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
TIGRFAMs | TIGR01557 | 5.1E-27 | 1 | 56 | IPR006447 | Myb domain, plants |
PROSITE profile | PS51294 | 16.589 | 1 | 58 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 4.48E-18 | 1 | 55 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 2.1E-32 | 1 | 56 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 2.2E-9 | 3 | 54 | IPR001005 | SANT/Myb domain |
Pfam | PF14379 | 2.6E-23 | 82 | 129 | IPR025756 | MYB-CC type transcription factor, LHEQLE-containing domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 133 aa Download sequence Send to blast |
KQRLRWTSEL HDRFVEAVTQ LGGPDRATPK GVLRIMGVHG LTIYHVKSHL QKYRLAKFIP 60 DSSGDGTLFD SYLSSKCLCR GIQLTEALRM QMEVQKRLHE QLEVQRQLQL RIEAQSTYLA 120 KIIEEQQKMR GML |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6j4r_A | 3e-26 | 1 | 58 | 1 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j4r_B | 3e-26 | 1 | 58 | 1 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j4r_C | 3e-26 | 1 | 58 | 1 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j4r_D | 3e-26 | 1 | 58 | 1 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
Search in ModeBase |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00252 | DAP | Transfer from AT2G01060 | Download |
![]() |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024534757.1 | 2e-78 | myb family transcription factor PHL6 | ||||
Refseq | XP_024534758.1 | 2e-78 | myb family transcription factor PHL6 | ||||
Refseq | XP_024544435.1 | 2e-78 | myb family transcription factor PHL6 | ||||
Refseq | XP_024544436.1 | 2e-78 | myb family transcription factor PHL6 | ||||
Swissprot | Q9SJW0 | 4e-66 | PHL7_ARATH; Myb family transcription factor PHL7 | ||||
TrEMBL | D8RS23 | 9e-93 | D8RS23_SELML; Uncharacterized protein (Fragment) | ||||
STRING | EFJ24990 | 2e-93 | (Selaginella moellendorffii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP78 | 17 | 262 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G01060.1 | 8e-53 | G2-like family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | 57477 |
Entrez Gene | 9643035 |
Publications ? help Back to Top | |||
---|---|---|---|
|