PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella

Family

ARR-B

Protein Properties

Length: 270aa MW: 30682.6 Da PI: 7.0018

Description

ARR-B family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
55595	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	G2-like	91.6	6.5e-29	210	263	1	55
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 k+r++W+ eLH++Fv+av+qL G++kA+Pk+ile m+v+gLt+e+v+SHLQkYRl 55595 210 KQRVVWSVELHQQFVNAVNQL-GIDKAVPKKILESMSVHGLTRENVASHLQKYRL 263 79*****************.******************************8 PP
2	Response_reg	72.8	1.4e-24	8	116	1	109
EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS Response_reg 1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 vl vdD+p+ +++l+q+l+k y ev+ ++ ++eal ll+e++ +Dl++ D+ mp+mdG++ll+ e +lp+i+ +++ge + + + Ga 55595 8 VLAVDDDPTCLRILAQMLRKCSY-EVTMCTRATEALSLLRENKdrFDLMISDVFMPDMDGFKLLEYVGLEM-DLPVIMTSSNGETGIVMKGVIHGAC 102 799******************.***********888889******************6644.8******************** PP EEEESS--HHHHHH CS Response_reg 96 dflsKpfdpeelvk 109 d+l Kp+ eel++ 55595 103 DYLIKPVRTEELRN 116 *********997 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PIRSF	PIRSF036392	5.1E-144	1	270	IPR017053	Response regulator B-type, plant
Gene3D	G3DSA:3.40.50.2300	5.4E-42	5	160	No hit	No description
SuperFamily	SSF52172	1.85E-35	5	133	IPR011006	CheY-like superfamily
SMART	SM00448	5.3E-27	6	118	IPR001789	Signal transduction response regulator, receiver domain
PROSITE profile	PS50110	40.759	7	122	IPR001789	Signal transduction response regulator, receiver domain
Pfam	PF00072	3.2E-22	8	117	IPR001789	Signal transduction response regulator, receiver domain
CDD	cd00156	5.51E-24	9	121	No hit	No description
SuperFamily	SSF46689	5.29E-20	207	267	IPR009057	Homeodomain-like
PROSITE profile	PS51294	11.62	207	266	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	2.8E-29	209	268	IPR009057	Homeodomain-like
TIGRFAMs	TIGR01557	8.4E-26	210	263	IPR006447	Myb domain, plants
Pfam	PF00249	8.9E-8	212	262	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0000160	Biological Process	phosphorelay signal transduction system
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009414	Biological Process	response to water deprivation
GO:0010082	Biological Process	regulation of root meristem growth
GO:0010380	Biological Process	regulation of chlorophyll biosynthetic process
GO:0031537	Biological Process	regulation of anthocyanin metabolic process
GO:0048367	Biological Process	shoot system development
GO:0080022	Biological Process	primary root development
GO:0080036	Biological Process	regulation of cytokinin-activated signaling pathway
GO:0080113	Biological Process	regulation of seed growth
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 270 aa Download sequence Send to blast
KFPAGLRVLA VDDDPTCLRI LAQMLRKCSY EVTMCTRATE ALSLLRENKD RFDLMISDVF 60 MPDMDGFKLL EYVGLEMDLP VIMTSSNGET GIVMKGVIHG ACDYLIKPVR TEELRNIWQH 120 VVRKKRNEAR DVEASGSVED GGERNHHHHH QQQQHHSSQQ QRRASTIDEG EFNSDGGGGG 180 DPNWKLAKRR KDDGDETAEH DNDDSSTLKK QRVVWSVELH QQFVNAVNQL GIDKAVPKKI 240 LESMSVHGLT RENVASHLQK YRLYLRRLSG

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1irz_A	7e-19	209	269	4	64	ARR10-B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. Could directly activate some type-A response regulators in response to cytokinins. Regulates SHY2 by binding to its promoter (PubMed:19039136). Involved in the root-meristem size determination through the regulation of cell differentiation (PubMed:17363254). {ECO:0000269\|PubMed:11574878, ECO:0000269\|PubMed:11691951, ECO:0000269\|PubMed:17363254, ECO:0000269\|PubMed:19039136}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Down-regulated by gibberellin. {ECO:0000269\|PubMed:20605455}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002978969.1	0.0	two-component response regulator ARR1 isoform X1
Swissprot	Q940D0	1e-109	ARR1_ARATH; Two-component response regulator ARR1
TrEMBL	D8S6D8	0.0	D8S6D8_SELML; Type B response regulator
TrEMBL	D8TEH9	0.0	D8TEH9_SELML; Uncharacterized protein RR3-2 (Fragment)
STRING	EFJ04946	0.0	(Selaginella moellendorffii)
STRING	EFJ19926	0.0	(Selaginella moellendorffii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP292	17	120

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G16857.1	1e-109	response regulator 1

Link Out ? help Back to Top
Phytozome	55595
Entrez Gene	9659593

Publications ? help Back to Top
Bürkle L,Meyer S,Dortay H,Lehrach H,Heyl A In vitro recombination cloning of entire cDNA libraries in Arabidopsis thaliana and its application to the yeast two-hybrid system. Funct. Integr. Genomics, 2005. 5(3): p. 175-83 [PMID:15714319] Banks JA, et al. The Selaginella genome identifies genetic changes associated with the evolution of vascular plants. Science, 2011. 332(6032): p. 960-3 [PMID:21551031] Moubayidin L, et al. Spatial coordination between stem cell activity and cell differentiation in the root meristem. Dev. Cell, 2013. 26(4): p. 405-15 [PMID:23987513] Takahashi N, et al. Cytokinins control endocycle onset by promoting the expression of an APC/C activator in Arabidopsis roots. Curr. Biol., 2013. 23(18): p. 1812-7 [PMID:24035544] Kurepa J,Li Y,Perry SE,Smalle JA Ectopic expression of the phosphomimic mutant version of Arabidopsis response regulator 1 promotes a constitutive cytokinin response phenotype. BMC Plant Biol., 2014. 14: p. 28 [PMID:24423196] Cortleven A, et al. A novel protective function for cytokinin in the light stress response is mediated by the Arabidopsis histidine kinase2 and Arabidopsis histidine kinase3 receptors. Plant Physiol., 2014. 164(3): p. 1470-83 [PMID:24424319] Marín-de la Rosa N, et al. Genome Wide Binding Site Analysis Reveals Transcriptional Coactivation of Cytokinin-Responsive Genes by DELLA Proteins. PLoS Genet., 2015. 11(7): p. e1005337 [PMID:26134422] D'Alessandro S,Golin S,Hardtke CS,Lo Schiavo F,Zottini M The co-chaperone p23 controls root development through the modulation of auxin distribution in the Arabidopsis root meristem. J. Exp. Bot., 2015. 66(16): p. 5113-22 [PMID:26163704] Jiang L, et al. Strigolactones spatially influence lateral root development through the cytokinin signaling network. J. Exp. Bot., 2016. 67(1): p. 379-89 [PMID:26519957] Moubayidin L, et al. A SCARECROW-based regulatory circuit controls Arabidopsis thaliana meristem size from the root endodermis. Planta, 2016. 243(5): p. 1159-68 [PMID:26848984] Muraro D, et al. A multi-scale model of the interplay between cell signalling and hormone transport in specifying the root meristem of Arabidopsis thaliana. J. Theor. Biol., 2016. 404: p. 182-205 [PMID:27157127] Cortleven A, et al. Cytokinin Regulates the Etioplast-Chloroplast Transition through the Two-Component Signaling System and Activation of Chloroplast-Related Genes. Plant Physiol., 2016. 172(1): p. 464-78 [PMID:27388681] Kobayashi K, et al. Shoot Removal Induces Chloroplast Development in Roots via Cytokinin Signaling. Plant Physiol., 2017. 173(4): p. 2340-2355 [PMID:28193764] Zhang TQ, et al. A Two-Step Model for de Novo Activation of WUSCHEL during Plant Shoot Regeneration. Plant Cell, 2017. 29(5): p. 1073-1087 [PMID:28389585] Kushwah S,Laxmi A The interaction between glucose and cytokinin signaling in controlling Arabidopsis thaliana seedling root growth and development. Plant Signal Behav, 2017. 12(5): p. e1312241 [PMID:28467152] Meng WJ, et al. Type-B ARABIDOPSIS RESPONSE REGULATORs Specify the Shoot Stem Cell Niche by Dual Regulation of WUSCHEL. Plant Cell, 2017. 29(6): p. 1357-1372 [PMID:28576846] Kobayashi K,Iwase A Simultaneous but spatially different regulation of non-photosynthetic callus formation and photosynthetic root development after shoot removal. Plant Signal Behav, 2017. 12(6): p. e1338999 [PMID:28594268] Liu B,De Storme N,Geelen D Cold interferes with male meiotic cytokinesis in Arabidopsis thaliana independently of the AHK2/3-AHP2/3/5 cytokinin signaling module. Cell Biol. Int., 2017. 41(8): p. 879-889 [PMID:28618065] Zhang F,May A,Irish VF Type-B ARABIDOPSIS RESPONSE REGULATORs Directly Activate WUSCHEL. Trends Plant Sci., 2017. 22(10): p. 815-817 [PMID:28886911] Yan Z, et al. Type B Response Regulators Act As Central Integrators in Transcriptional Control of the Auxin Biosynthesis Enzyme TAA1. Plant Physiol., 2017. 175(3): p. 1438-1454 [PMID:28931628] Rong XF, et al. Type-B ARRs Control Carpel Regeneration Through Mediating AGAMOUS Expression in Arabidopsis. Plant Cell Physiol., 2018. 59(4): p. 756-764 [PMID:29186581] Bustillo-Avendaño E, et al. Regulation of Hormonal Control, Cell Reprogramming, and Patterning during De Novo Root Organogenesis. Plant Physiol., 2018. 176(2): p. 1709-1727 [PMID:29233938] Waldie T,Leyser O Cytokinin Targets Auxin Transport to Promote Shoot Branching. Plant Physiol., 2018. 177(2): p. 803-818 [PMID:29717021]