![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 493831 | ||||||||
Common Name | ARALYDRAFT_493831 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 180aa MW: 20854.6 Da PI: 8.7827 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 102 | 3.4e-32 | 97 | 155 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK+vk + +prsYYrCt+++C+vkk+v+r a+dp+vv++tYeg Hnh+ 493831 97 LDDGYRWRKYGQKSVKHNAHPRSYYRCTYHTCNVKKQVQRLAKDPNVVVTTYEGIHNHP 155 59********************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 3.3E-32 | 84 | 155 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 3.4E-28 | 89 | 156 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 28.943 | 92 | 157 | IPR003657 | WRKY domain |
SMART | SM00774 | 7.4E-37 | 97 | 156 | IPR003657 | WRKY domain |
Pfam | PF03106 | 1.6E-25 | 98 | 155 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 180 aa Download sequence Send to blast |
MEREDINHML SLDVENNNTF SAFVDKTLMM MPPLTFSGEV EPSSSSSWYP ESFHVHVPPP 60 APENDQIGEK GKKKEKEKRS RKVPRIAFQT RSDDDVLDDG YRWRKYGQKS VKHNAHPRSY 120 YRCTYHTCNV KKQVQRLAKD PNVVVTTYEG IHNHPCEKLM ETLNPLLRQL QFLSSFSNL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 6e-27 | 87 | 154 | 7 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 6e-27 | 87 | 154 | 7 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00539 | DAP | Transfer from AT5G41570 | Download |
![]() |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 493831 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF404864 | 0.0 | AF404864.1 Arabidopsis thaliana WRKY transcription factor 24 (WRKY24) mRNA, complete cds. | |||
GenBank | AK227522 | 0.0 | AK227522.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL14-13-N18. | |||
GenBank | BT004595 | 0.0 | BT004595.1 Arabidopsis thaliana At5g41570 gene, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020875227.1 | 1e-134 | probable WRKY transcription factor 24 | ||||
Swissprot | Q9FFS3 | 1e-117 | WRK24_ARATH; Probable WRKY transcription factor 24 | ||||
TrEMBL | D7MIT9 | 1e-133 | D7MIT9_ARALL; Uncharacterized protein | ||||
STRING | fgenesh2_kg.7__3264__AT5G41570.1 | 1e-133 | (Arabidopsis lyrata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM509 | 28 | 154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G41570.1 | 1e-100 | WRKY DNA-binding protein 24 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 493831 |
Entrez Gene | 9304658 |