PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella

Family

LBD

Protein Properties

Length: 110aa MW: 12159 Da PI: 8.3838

Description

LBD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
49084	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	DUF260	143.2	8.1e-45	2	100	1	99
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 +CaaCk+lrr+Ca+dC++apyfp ++p+kfa+vhk+FGasnv+k+l++lp ++r da+ s+vyeA+ar+rdPvyG+vg i++l+qq++ql+++la ++ 49084 2 PCAACKLLRRRCAQDCIFAPYFPPDEPQKFAFVHKVFGASNVSKMLQDLPLHQRGDAVGSMVYEANARVRDPVYGCVGAISALHQQIAQLQTQLAISQA 100 7*********************************************************************************************99886 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50891	25.954	1	102	IPR004883	Lateral organ boundaries, LOB
Pfam	PF03195	1.2E-44	2	99	IPR004883	Lateral organ boundaries, LOB

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009965	Biological Process	leaf morphogenesis

Sequence ? help Back to Top
Protein Sequence Length: 110 aa Download sequence Send to blast
SPCAACKLLR RRCAQDCIFA PYFPPDEPQK FAFVHKVFGA SNVSKMLQDL PLHQRGDAVG 60 SMVYEANARV RDPVYGCVGA ISALHQQIAQ LQTQLAISQA ENVCLRMQHS

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5ly0_A	2e-47	1	101	10	110	LOB family transfactor Ramosa2.1
5ly0_B	2e-47	1	101	10	110	LOB family transfactor Ramosa2.1
Search in ModeBase

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002984853.2	5e-78	LOB domain-containing protein 4
Swissprot	Q8LBW3	6e-61	LBD12_ARATH; LOB domain-containing protein 12
TrEMBL	D8SN28	9e-76	D8SN28_SELML; Uncharacterized protein (Fragment)
STRING	EFJ14103	2e-76	(Selaginella moellendorffii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP60	16	318

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G30130.1	5e-53	LBD family protein

Link Out ? help Back to Top
Phytozome	49084
Entrez Gene	9645000

Publications ? help Back to Top
Penfield S, et al. Reserve mobilization in the Arabidopsis endosperm fuels hypocotyl elongation in the dark, is independent of abscisic acid, and requires PHOSPHOENOLPYRUVATE CARBOXYKINASE1. Plant Cell, 2004. 16(10): p. 2705-18 [PMID:15367715] Banks JA, et al. The Selaginella genome identifies genetic changes associated with the evolution of vascular plants. Science, 2011. 332(6032): p. 960-3 [PMID:21551031]