PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

MYB

Protein Properties

Length: 283aa MW: 31843.5 Da PI: 9.0543

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
490626	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	55.3	1.5e-17	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEde+l+ ++k +G g+W++ ++ g+ R++k+c++rw +yl 490626 14 KGAWTKEEDERLIAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINYL 61 79****************************99**********97 PP
2	Myb_DNA-binding	59.9	5.4e-19	67	111	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg++T+eEdel+++++ +lG++ W++Ia +++ gRt++++k++w+++ 490626 67 RGNFTEEEDELIIKLHSLLGNK-WSLIAGRLP-GRTDNEIKNYWNTH 111 89******************.*****.**********97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	1.8E-24	5	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	17.216	9	61	IPR017930	Myb domain
SuperFamily	SSF46689	4.23E-30	13	108	IPR009057	Homeodomain-like
SMART	SM00717	5.1E-14	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	2.4E-15	14	61	IPR001005	SANT/Myb domain
CDD	cd00167	8.44E-11	16	61	No hit	No description
PROSITE profile	PS51294	29.411	62	116	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	2.4E-28	65	117	IPR009057	Homeodomain-like
SMART	SM00717	6.3E-18	66	114	IPR001005	SANT/Myb domain
Pfam	PF00249	3.6E-17	67	111	IPR001005	SANT/Myb domain
CDD	cd00167	5.93E-13	69	112	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009751	Biological Process	response to salicylic acid
GO:0009753	Biological Process	response to jasmonic acid
GO:0010224	Biological Process	response to UV-B
GO:0045892	Biological Process	negative regulation of transcription, DNA-templated
GO:1903086	Biological Process	negative regulation of sinapate ester biosynthetic process
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 283 aa Download sequence Send to blast
MGRSPCCEKA HTNKGAWTKE EDERLIAYIK AHGEGCWRSL PKAAGLLRCG KSCRLRWINY 60 LRPDLKRGNF TEEEDELIIK LHSLLGNKWS LIAGRLPGRT DNEIKNYWNT HIRRKLINRG 120 IDPTTHRPIQ ESSASQDSKP TQLEPVTSNT INISFTSAPK VETFHESISF PEKISMLTFK 180 EEKDECPVAE KFPDLNLELR ISLPDDVDRR RGLVGHGKST TPRCFKCSLG MINGMECRCG 240 RMRCDVVGGS SKGSDLSKGF DFLGLAKKET TSLLGFRSLE MK*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	4e-30	13	116	26	128	MYB TRANSFORMING PROTEIN
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription repressor involved in regulation of protection against UV. Mediates transcriptional repression of CYP73A5, the gene encoding trans-cinnamate 4-monooxygenase, thereby regulating the accumulation of the UV-protectant compound sinapoylmalate. {ECO:0000269\|PubMed:11080161}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00479	DAP	Transfer from AT4G38620	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	490626

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Down-regulated by exposure to UV-B light. {ECO:0000269\|PubMed:11080161}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AY070100	0.0	AY070100.1 Arabidopsis thaliana putative transcription factor MYB4 (At4g38620) mRNA, complete cds.
GenBank	AY123004	0.0	AY123004.1 Arabidopsis thaliana putative transcription factor MYB4 (At4g38620) mRNA, complete cds.
GenBank	AY140037	0.0	AY140037.1 Arabidopsis thaliana putative transcription factor MYB4 (At4g38620) mRNA, complete cds.
GenBank	AY519615	0.0	AY519615.1 Arabidopsis thaliana MYB transcription factor (At4g38620) mRNA, complete cds.
GenBank	BT006302	0.0	BT006302.1 Arabidopsis thaliana At4g38620 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020872408.1	0.0	transcription repressor MYB4
Swissprot	Q9SZP1	0.0	MYB4_ARATH; Transcription repressor MYB4
TrEMBL	D7MFL7	0.0	D7MFL7_ARALL; Uncharacterized protein
STRING	fgenesh2_kg.7__59__AT4G38620.1	0.0	(Arabidopsis lyrata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4	28	2646

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G38620.1	0.0	myb domain protein 4

Link Out ? help Back to Top
Phytozome	490626
Entrez Gene	9304922

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Schenke D,Cai D,Scheel D Suppression of UV-B stress responses by flg22 is regulated at the chromatin level via histone modification. Plant Cell Environ., 2014. 37(7): p. 1716-21 [PMID:24450952] Zhou M, et al. Changing a conserved amino acid in R2R3-MYB transcription repressors results in cytoplasmic accumulation and abolishes their repressive activity in Arabidopsis. Plant J., 2015. 84(2): p. 395-403 [PMID:26332741] Zhang J, et al. Soybean SPX1 is an important component of the response to phosphate deficiency for phosphorus homeostasis. Plant Sci., 2016. 248: p. 82-91 [PMID:27181950] Zhou M, et al. LNK1 and LNK2 Corepressors Interact with the MYB3 Transcription Factor in Phenylpropanoid Biosynthesis. Plant Physiol., 2017. 174(3): p. 1348-1358 [PMID:28483877] Mondal SK,Roy S Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275] Verma N,Burma PK Regulation of tapetum-specific A9 promoter by transcription factors AtMYB80, AtMYB1 and AtMYB4 in Arabidopsis thaliana and Nicotiana tabacum. Plant J., 2017. 92(3): p. 481-494 [PMID:28849604]