![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 488428 | ||||||||
Common Name | ARALYDRAFT_488428 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 185aa MW: 21433.5 Da PI: 5.9364 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 46.5 | 8e-15 | 73 | 129 | 5 | 61 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 +++rr+ +NRe+ArrsR RK+ ++eL v+ L +eN++L ++l++ +++ +++ + 488428 73 RKQRRMVSNRESARRSRMRKQRHLDELLSQVAWLRSENHQLLDKLNQVSDNNDRVIQ 129 689********************************************9999877655 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 2.8E-13 | 69 | 133 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.909 | 71 | 134 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 1.2E-11 | 72 | 126 | No hit | No description |
Pfam | PF00170 | 1.4E-12 | 73 | 127 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 4.29E-13 | 73 | 123 | No hit | No description |
CDD | cd14702 | 4.00E-18 | 74 | 121 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 76 | 91 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 185 aa Download sequence Send to blast |
MQPNYDSSSL NNMQQQDYFH LNYYNNLNPS TNNNNLNLLQ YPQIQELNLQ SPVSNNSTTS 60 DDATEGIFVI NERKQRRMVS NRESARRSRM RKQRHLDELL SQVAWLRSEN HQLLDKLNQV 120 SDNNDRVIQE NLSLKEENLE LRQVITSVKK LGGGIHDKYS SSSMDELDQD FSSITDDPRT 180 HHPS* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 85 | 92 | RRSRMRKQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00512 | DAP | Transfer from AT5G15830 | Download |
![]() |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 488428 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK117828 | 0.0 | AK117828.1 Arabidopsis thaliana At5g15830 mRNA for putative bZIP transcription factor AtbZip3, complete cds, clone: RAFL18-02-O03. | |||
GenBank | AL391144 | 0.0 | AL391144.1 Arabidopsis thaliana DNA chromosome 5, BAC clone F14F8 (ESSA project). | |||
GenBank | BT003683 | 0.0 | BT003683.1 Arabidopsis thaliana At5g15830 mRNA, complete cds. | |||
GenBank | CP002688 | 0.0 | CP002688.1 Arabidopsis thaliana chromosome 5 sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020876606.1 | 1e-131 | basic leucine zipper 43 | ||||
Swissprot | Q9FMC2 | 1e-32 | BZP43_ARATH; Basic leucine zipper 43 | ||||
TrEMBL | D7M7G7 | 1e-130 | D7M7G7_ARALL; Uncharacterized protein | ||||
STRING | fgenesh2_kg.6__1562__AT5G15830.1 | 1e-131 | (Arabidopsis lyrata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM10632 | 15 | 32 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G15830.1 | 2e-99 | basic leucine-zipper 3 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 488428 |
Entrez Gene | 9307756 |
Publications ? help Back to Top | |||
---|---|---|---|
|