PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 487538 | ||||||||
Common Name | ARALYDRAFT_487538 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 151aa MW: 16995.5 Da PI: 9.9742 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 37.3 | 5.8e-12 | 50 | 105 | 5 | 60 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklk 60 k+ +r ++NR+AA++sR +K ++i+ L +++ eL+++ ++L++el +++ +l+ 487538 50 KKLKRIISNRVAAQKSRWKKVQYIDALVKRSMELQGQVSMLRSELAIASEHKRRLE 105 899*****************************************987776666655 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.20.5.170 | 5.7E-12 | 42 | 107 | No hit | No description |
SMART | SM00338 | 4.6E-13 | 46 | 110 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 9.209 | 48 | 111 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 4.08E-10 | 50 | 105 | No hit | No description |
Pfam | PF00170 | 6.5E-10 | 50 | 106 | IPR004827 | Basic-leucine zipper domain |
CDD | cd14703 | 2.85E-11 | 51 | 102 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 53 | 68 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 151 aa Download sequence Send to blast |
MSFPVVATSF GVSQSGSQAG EKKGGYVHYE VEPGFTIRMR HDIDPTTDPK KLKRIISNRV 60 AAQKSRWKKV QYIDALVKRS MELQGQVSML RSELAIASEH KRRLENEQRQ LKECISARVQ 120 HCIDSDGVIE ECKAEIERLK KNLAPLSNLS * |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 487538 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY960974 | 1e-167 | AY960974.1 Arabidopsis thaliana activator of spomin LUC3 (ASML3) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002873298.1 | 1e-108 | basic leucine zipper 34 | ||||
TrEMBL | D7LZY2 | 1e-107 | D7LZY2_ARALL; DNA binding protein | ||||
STRING | fgenesh2_kg.6__672__AT5G07160.1 | 1e-108 | (Arabidopsis lyrata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM14418 | 18 | 21 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G07160.1 | 4e-97 | bZIP family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | 487538 |
Entrez Gene | 9307324 |