PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 485555 | ||||||||
Common Name | ARALYDRAFT_485555 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 212aa MW: 24141.8 Da PI: 6.1197 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 32.3 | 2.2e-10 | 80 | 129 | 5 | 54 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 + +r NReA r++R++Kka+++ Le++vk L++ N+++ +l++ + 485555 80 SNKKRSCGNREAVRKYREKKKARTAYLEDEVKRLQSLNEQMLRKLQSQEM 129 67899999*********************************999887554 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.20.5.170 | 4.0E-10 | 72 | 143 | No hit | No description |
SMART | SM00338 | 1.6E-6 | 75 | 143 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF07716 | 3.2E-14 | 76 | 128 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 8.852 | 78 | 144 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 8.75E-8 | 79 | 127 | No hit | No description |
CDD | cd14686 | 1.22E-10 | 88 | 129 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0042538 | Biological Process | hyperosmotic salinity response | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0005737 | Cellular Component | cytoplasm | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 212 aa Download sequence Send to blast |
DFRGNQQGSN FDSLRGVFFG DLWMDEEEGK DQDRVTRGCS HTHSCNPPGP EDAFHSHTCF 60 HAHTHLIIPD QQENDHSDSS NKKRSCGNRE AVRKYREKKK ARTAYLEDEV KRLQSLNEQM 120 LRKLQSQEMM ESELIRLRTL VVEMQGKIDV ELCGFSFQKQ CNGSGFVYKE DGCSVATSNM 180 MCEAARVECE EGQTLHDPIH SFVPQSPPFS H* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in the regulation of salt stress response. Functions as a negative transcriptional regulator of salt stress acclimation response by regulating cation homeostasis (PubMed:18703123, PubMed:19248824). Regulates negatively the expression of genes contributing to ion and osmotic homeostasis during salt stress, such as the Na(+) transporter HKT1, the Na(+)/H(+) antiporter SOS1, the aquaporin PIP2-1 and the glutamine synthetase GLN1-3. In addition, targets genes with functions in plant growth and development, such as argonaute 4 (AGO4) and cyclophilin 19 (CYP19) (PubMed:19248824). {ECO:0000269|PubMed:18703123, ECO:0000269|PubMed:19248824}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 485555 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salt stress (PubMed:18703123, PubMed:19248824). Induced by osmotic stress (PubMed:19248824). {ECO:0000269|PubMed:18703123, ECO:0000269|PubMed:19248824}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK117629 | 0.0 | AK117629.1 Arabidopsis thaliana At3g51960 mRNA for putative bZip transcription factor Atbzip24, complete cds, clone: RAFL17-28-M01. | |||
GenBank | BT005422 | 0.0 | BT005422.1 Arabidopsis thaliana clone U50385 putative bZIP family transcription factor (At3g51960) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020882554.1 | 1e-140 | basic leucine zipper 24 | ||||
Refseq | XP_020882555.1 | 1e-140 | basic leucine zipper 24 | ||||
Refseq | XP_020882556.1 | 1e-140 | basic leucine zipper 24 | ||||
Refseq | XP_020882557.1 | 1e-140 | basic leucine zipper 24 | ||||
Refseq | XP_020882558.1 | 1e-140 | basic leucine zipper 24 | ||||
Swissprot | Q8GTS1 | 1e-135 | BZP24_ARATH; Basic leucine zipper 24 | ||||
TrEMBL | D7LU06 | 1e-158 | D7LU06_ARALL; BZIP family transcription factor (Fragment) | ||||
STRING | fgenesh2_kg.5__1547__AT3G51960.2 | 1e-158 | (Arabidopsis lyrata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM15172 | 15 | 18 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G51960.1 | 1e-137 | basic leucine zipper 24 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 485555 |
Entrez Gene | 9313905 |