![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 483701 | ||||||||
Common Name | ARALYDRAFT_483701 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 250aa MW: 28558.4 Da PI: 8.6944 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 100.1 | 8.4e-32 | 9 | 58 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krienk+nrqvtfskRrng+lKKA+ELSvLCdaeva+iifss+gklye+ 483701 9 KRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFG 58 79**********************************************95 PP | |||||||
2 | K-box | 99.8 | 3.9e-33 | 78 | 171 | 6 | 99 |
K-box 6 gksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 ++++ e++++s++qe++kLk+++e+L r++R+llGedL+++ +keLq Le+qLe +l+ R++K+++++e++e+l+kke++l ++nk+L+ k+e 483701 78 SNNKPEETTQSWCQEVTKLKSKYESLVRTNRNLLGEDLGEMGVKELQALERQLEAALTATRQRKTQVMMEEMEDLRKKERQLGDINKQLKIKFE 171 45578899**********************************************************************************9987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 33.431 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 7.4E-42 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 9.36E-44 | 2 | 72 | No hit | No description |
SuperFamily | SSF55455 | 1.44E-33 | 2 | 89 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.1E-32 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 3.0E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.1E-32 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.1E-32 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 8.2E-30 | 83 | 170 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 15.279 | 86 | 176 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009553 | Biological Process | embryo sac development | ||||
GO:0009911 | Biological Process | positive regulation of flower development | ||||
GO:0010094 | Biological Process | specification of carpel identity | ||||
GO:0010228 | Biological Process | vegetative to reproductive phase transition of meristem | ||||
GO:0010582 | Biological Process | floral meristem determinacy | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0048455 | Biological Process | stamen formation | ||||
GO:0048459 | Biological Process | floral whorl structural organization | ||||
GO:0048509 | Biological Process | regulation of meristem development | ||||
GO:0048833 | Biological Process | specification of floral organ number | ||||
GO:0080060 | Biological Process | integument development | ||||
GO:0080112 | Biological Process | seed growth | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 250 aa Download sequence Send to blast |
MGRGRVEMKR IENKINRQVT FSKRRNGLLK KAYELSVLCD AEVALIIFSS RGKLYEFGSV 60 GIARTIERYN RCYNCTLSNN KPEETTQSWC QEVTKLKSKY ESLVRTNRNL LGEDLGEMGV 120 KELQALERQL EAALTATRQR KTQVMMEEME DLRKKERQLG DINKQLKIKF ETEGHAFKTF 180 QDLWANSAAG DRNNSEFPVE PSHPISLDCN TEPFLQIGFQ QHYYVQGEGS SVSKSNVAGE 240 TNFVQGWVL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 1e-20 | 1 | 69 | 1 | 69 | MEF2C |
5f28_B | 1e-20 | 1 | 69 | 1 | 69 | MEF2C |
5f28_C | 1e-20 | 1 | 69 | 1 | 69 | MEF2C |
5f28_D | 1e-20 | 1 | 69 | 1 | 69 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. Forms a heterodimer via the K-box domain with AG, that could be involved in genes regulation during floral meristem development. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00315 | DAP | Transfer from AT2G45650 | Download |
![]() |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 483701 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | ATHAGL6A | 0.0 | M55554.1 Arabidopsis thaliana transcription factor (AGL6) mRNA, complete cds. | |||
GenBank | DQ446624 | 0.0 | DQ446624.1 Arabidopsis thaliana clone pENTR221-At2g45650 MADS-box protein (At2g45650) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020884706.1 | 0.0 | agamous-like MADS-box protein AGL6 | ||||
Swissprot | P29386 | 1e-180 | AGL6_ARATH; Agamous-like MADS-box protein AGL6 | ||||
TrEMBL | D7LD69 | 0.0 | D7LD69_ARALL; Uncharacterized protein | ||||
TrEMBL | I7FF45 | 0.0 | I7FF45_ARALY; AGAMOUS-like protein 6 | ||||
STRING | fgenesh2_kg.4__2761__AT2G45650.1 | 0.0 | (Arabidopsis lyrata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4302 | 26 | 54 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G45650.1 | 1e-169 | AGAMOUS-like 6 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 483701 |
Entrez Gene | 9318090 |
Publications ? help Back to Top | |||
---|---|---|---|
|