PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

MYB_related

Protein Properties

Length: 85aa MW: 10464 Da PI: 9.2298

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
481955	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	22.8	2.2e-07	35	74	4	45
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 +T++E++l+ + ++ G + W++Iar++ gR + ++ +w 481955 35 MTEQEEDLIFRMYRLVGDR-WDLIARRVV-GREAMEIERYWI 74 7**************99.*****.*****99995 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00717	1.4E-5	31	79	IPR001005	SANT/Myb domain
CDD	cd00167	3.55E-5	34	73	No hit	No description
Pfam	PF00249	2.2E-6	35	74	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	1.3E-8	35	74	IPR009057	Homeodomain-like
SuperFamily	SSF46689	1.12E-6	36	74	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:2000039	Biological Process	regulation of trichome morphogenesis
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 85 aa Download sequence Send to blast
MDNTNRLRRL QGRKQPKFTH NSEEVCSMKW EFINMTEQEE DLIFRMYRLV GDRWDLIARR 60 VVGREAMEIE RYWIMRNSDF FSQK*

Functional Description ? help Back to Top
Source	Description
UniProt	MYB-type transcription factor involved in trichome cell specification. Acts as a negative regulator of trichome patterning and formation by direct binding to the cis-acting regulatory elements of GL1, thus suppressing the expression of GL1. {ECO:0000269\|PubMed:17933793}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	481955

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	DQ108777	1e-102	DQ108777.1 Arabidopsis thaliana clone 22671 mRNA sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020885158.1	9e-57	MYB-like transcription factor TCL1
Swissprot	D3GKW6	4e-50	TCL1_ARATH; MYB-like transcription factor TCL1
TrEMBL	D7LC52	2e-55	D7LC52_ARALL; DNA binding protein
STRING	fgenesh2_kg.4__1015__AT2G30432.1	3e-56	(Arabidopsis lyrata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM323	28	194

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G30432.1	2e-52	MYB_related family protein

Link Out ? help Back to Top
Phytozome	481955
Entrez Gene	9317177

Publications ? help Back to Top
Alexandrov NN, et al. Features of Arabidopsis genes and genome discovered using full-length cDNAs. Plant Mol. Biol., 2006. 60(1): p. 69-85 [PMID:16463100] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Zheng K, et al. Ectopic expression of R3 MYB transcription factor gene OsTCL1 in Arabidopsis, but not rice, affects trichome and root hair formation. Sci Rep, 2016. 6: p. 19254 [PMID:26758286] Hegebarth D,Buschhaus C,Wu M,Bird D,Jetter R The composition of surface wax on trichomes of Arabidopsis thaliana differs from wax on other epidermal cells. Plant J., 2016. 88(5): p. 762-774 [PMID:27496682] Tian H, et al. NTL8 Regulates Trichome Formation in Arabidopsis by Directly Activating R3 MYB Genes TRY and TCL1. Plant Physiol., 2017. 174(4): p. 2363-2375 [PMID:28649093]