![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 476870 | ||||||||
Common Name | ARALYDRAFT_476870 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 193aa MW: 21574.8 Da PI: 5.0529 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 69.6 | 2.9e-22 | 9 | 57 | 1 | 49 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49 krienks rqvtfskRrng++ KA LS+LC+ vav+++s +gklye 476870 9 KRIENKSSRQVTFSKRRNGLIDKARQLSILCESSVAVVVVSASGKLYES 57 79*********************************************95 PP | |||||||
2 | K-box | 33.1 | 2.4e-12 | 95 | 160 | 33 | 98 |
K-box 33 reqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 + q +l ++++ + L +Le+qLe++l+ R++K el++e ++ l++ke l+een+ L +++ 476870 95 TVQSKLEEPNVDNVRVDSLISLEEQLETALSVSRARKAELMMEYVKSLKEKEMLLREENQVLASQM 160 555555556677888999*******************************************99876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 2.3E-33 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 2.62E-24 | 1 | 64 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 28.413 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.0E-24 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.3E-21 | 10 | 56 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.0E-24 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.0E-24 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 11.176 | 76 | 166 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 6.2E-10 | 92 | 160 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 193 aa Download sequence Send to blast |
MGRRKIEIKR IENKSSRQVT FSKRRNGLID KARQLSILCE SSVAVVVVSA SGKLYESSSG 60 DEIEALVKPE ITQCFELDLA EKIQNYLPHK ELLETVQSKL EEPNVDNVRV DSLISLEEQL 120 ETALSVSRAR KAELMMEYVK SLKEKEMLLR EENQVLASQM GKNTLLAIED EGGMLPESSS 180 GNKIPETLPL LK* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 9e-16 | 1 | 68 | 1 | 68 | MEF2 CHIMERA |
6byy_B | 9e-16 | 1 | 68 | 1 | 68 | MEF2 CHIMERA |
6byy_C | 9e-16 | 1 | 68 | 1 | 68 | MEF2 CHIMERA |
6byy_D | 9e-16 | 1 | 68 | 1 | 68 | MEF2 CHIMERA |
6bz1_A | 9e-16 | 1 | 68 | 1 | 68 | MEF2 CHIMERA |
6bz1_B | 9e-16 | 1 | 68 | 1 | 68 | MEF2 CHIMERA |
6bz1_C | 9e-16 | 1 | 68 | 1 | 68 | MEF2 CHIMERA |
6bz1_D | 9e-16 | 1 | 68 | 1 | 68 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in the negative regulation of flowering time in both long and short days, probably through the photoperiodic and vernalization pathways. Prevents premature flowering. {ECO:0000269|PubMed:11351076, ECO:0000269|PubMed:14558654, ECO:0000269|PubMed:15695584, ECO:0000269|PubMed:18799658}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 476870 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Slightly repressed by vernalization. Negatively regulated at the chromatin level by VIL1 through the photoperiod and vernalization pathways. Requires EARLY FLOWERING 7 (ELF7) and ELF8 to be expressed. Up-regulated by HUA2. {ECO:0000269|PubMed:11351076, ECO:0000269|PubMed:15520273, ECO:0000269|PubMed:15659097, ECO:0000269|PubMed:17114575}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF312666 | 0.0 | AF312666.1 Arabidopsis thaliana MADS-box protein AGL27-II (AGL27) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002887668.1 | 1e-134 | agamous-like MADS-box protein AGL27 isoform X2 | ||||
Swissprot | Q9AT76 | 1e-104 | AGL27_ARATH; Agamous-like MADS-box protein AGL27 | ||||
TrEMBL | D7KU02 | 1e-133 | D7KU02_ARALL; Uncharacterized protein | ||||
STRING | fgenesh2_kg.2__2000__AT1G77080.2 | 1e-134 | (Arabidopsis lyrata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM986 | 19 | 87 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G77080.2 | 1e-115 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | 476870 |
Entrez Gene | 9325185 |