PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 473935 | ||||||||
Common Name | ARALYDRAFT_473935 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 215aa MW: 24883.8 Da PI: 8.6736 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 56.5 | 6.4e-18 | 7 | 54 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT +Ed +lv ++ ++G g+W++ +r g++Rt+k+c++rw++yl 473935 7 RGPWTVDEDMKLVSYISLHGEGRWNSLSRSAGLNRTGKSCRLRWLNYL 54 89********************************************97 PP | |||||||
2 | Myb_DNA-binding | 45.9 | 1.3e-14 | 60 | 103 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg + +E+ ++++++ ++G++ W++Ia++++ gRt++++k++w++ 473935 60 RGDISLQEQFIILELHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 103 5666889***************.*********.***********96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 23.19 | 1 | 58 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.66E-30 | 5 | 101 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 8.6E-15 | 6 | 56 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.5E-16 | 7 | 54 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.6E-21 | 8 | 61 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 4.22E-10 | 9 | 54 | No hit | No description |
SMART | SM00717 | 8.1E-13 | 59 | 107 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 16.094 | 59 | 109 | IPR017930 | Myb domain |
Pfam | PF00249 | 2.3E-13 | 60 | 103 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.1E-21 | 62 | 107 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 8.16E-9 | 64 | 103 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009651 | Biological Process | response to salt stress | ||||
GO:0009737 | Biological Process | response to abscisic acid | ||||
GO:0009751 | Biological Process | response to salicylic acid | ||||
GO:0046686 | Biological Process | response to cadmium ion | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 215 aa Download sequence Send to blast |
MEIEIRRGPW TVDEDMKLVS YISLHGEGRW NSLSRSAGLN RTGKSCRLRW LNYLRPDIRR 60 GDISLQEQFI ILELHSRWGN RWSKIAQHLP GRTDNEIKNY WRTRVQKHAK LLKCDVNSKQ 120 FKDTIKHLWM PRLVERIAST QNVEFTPNHY SPENSSVATA TSSTSSSESM ASSFYGDDQV 180 EYGTLDPNGG NWFNGGDAFE TLWSFDELNK WLLQ* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 8e-25 | 4 | 107 | 24 | 126 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in abiotic stress responses. Plays a regulatory role in tolerance to salt, cold, and drought stresses. Regulates positively the expression of genes involved in proline synthesis and transport, and genes involved in reactive oxygen species (ROS) scavenging such as peroxidase, superoxide dismutase and catalase during salt stress. Transactivates stress-related genes, including LEA3, RAB16A and DREB2A during salt stress. {ECO:0000269|PubMed:22301384}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 473935 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salt, cold and osmotic stresses, and abscisic acid (ABA). Down-regulated by salicylic acid (SA). {ECO:0000269|PubMed:22301384}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK229083 | 0.0 | AK229083.1 Arabidopsis thaliana mRNA for putative transcription factor MYB112, complete cds, clone: RAFL16-36-L19. | |||
GenBank | AY519562 | 0.0 | AY519562.1 Arabidopsis thaliana MYB transcription factor (At1g48000) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002894088.1 | 1e-159 | transcription factor MYB108 | ||||
Swissprot | Q10MB4 | 2e-82 | MYB2_ORYSJ; Transcription factor MYB2 | ||||
TrEMBL | D7KC02 | 1e-158 | D7KC02_ARALL; Uncharacterized protein | ||||
STRING | fgenesh2_kg.1__3889__AT1G48000.1 | 1e-159 | (Arabidopsis lyrata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G48000.1 | 1e-131 | myb domain protein 112 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 473935 |
Entrez Gene | 9327466 |
Publications ? help Back to Top | |||
---|---|---|---|
|