PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

MYB

Protein Properties

Length: 258aa MW: 29317.1 Da PI: 8.3498

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
472503	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	59.7	6.3e-19	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd+llvd+++++G g+W++ +r g+ R++k+c++rw +yl 472503 14 KGAWTKEEDQLLVDYIRKHGEGCWRSLPRAAGLQRCGKSCRLRWMNYL 61 79********************************************97 PP
2	Myb_DNA-binding	60.1	4.7e-19	67	111	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg++T+eEdel+++++ +lG++ W++Ia +++ gRt++++k++w+++ 472503 67 RGNFTEEEDELIIKLHSLLGNK-WSLIAGRLP-GRTDNEIKNYWNTH 111 89******************.*****.**********97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	5.3E-25	5	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	18.153	9	61	IPR017930	Myb domain
SuperFamily	SSF46689	2.08E-31	12	108	IPR009057	Homeodomain-like
SMART	SM00717	2.6E-14	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	1.4E-16	14	61	IPR001005	SANT/Myb domain
CDD	cd00167	2.71E-11	16	61	No hit	No description
PROSITE profile	PS51294	29.427	62	116	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	9.2E-29	65	116	IPR009057	Homeodomain-like
SMART	SM00717	4.6E-18	66	114	IPR001005	SANT/Myb domain
Pfam	PF00249	3.1E-17	67	111	IPR001005	SANT/Myb domain
CDD	cd00167	2.06E-12	69	112	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009611	Biological Process	response to wounding
GO:0009651	Biological Process	response to salt stress
GO:0009737	Biological Process	response to abscisic acid
GO:0009751	Biological Process	response to salicylic acid
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 258 aa Download sequence Send to blast
MGRSPCCEKA HMNKGAWTKE EDQLLVDYIR KHGEGCWRSL PRAAGLQRCG KSCRLRWMNY 60 LRPDLKRGNF TEEEDELIIK LHSLLGNKWS LIAGRLPGRT DNEIKNYWNT HIKRKLLSRG 120 IDPNTHRLIN ESAVVSPSSL QKDVVETLNL DFAGKVKPEP VREETGGINN CTSSGTTSEK 180 DYGNEEDWVL NLELSVGPSY RYESTRKVSV VDSAESTRRW GSELFRTQSD AVCLCCRVGL 240 YHNESCRNCR VSDVRTH*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	3e-30	12	116	25	128	MYB TRANSFORMING PROTEIN
Search in ModeBase

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00053	PBM	Transfer from AT1G22640	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	472503

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By nitrogen, salicylic acid, NaCl and abscisic acid (ABA). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:18541146, ECO:0000269\|PubMed:9839469}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AY072543	0.0	AY072543.1 Arabidopsis thaliana At1g22640/F12K8.1 mRNA, complete cds.
GenBank	BT000841	0.0	BT000841.1 Arabidopsis thaliana At1g22640/F12K8.1 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020867354.1	0.0	transcription factor MYB3
Swissprot	Q9S9K9	1e-177	MYB3_ARATH; Transcription factor MYB3
TrEMBL	D7KLT8	0.0	D7KLT8_ARALL; Uncharacterized protein
STRING	fgenesh2_kg.1__2457__AT1G22640.1	0.0	(Arabidopsis lyrata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4	28	2646

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G22640.1	1e-179	myb domain protein 3

Link Out ? help Back to Top
Phytozome	472503
Entrez Gene	9326585

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Zhou M, et al. Changing a conserved amino acid in R2R3-MYB transcription repressors results in cytoplasmic accumulation and abolishes their repressive activity in Arabidopsis. Plant J., 2015. 84(2): p. 395-403 [PMID:26332741] Wada T,Hayashi N,Tominaga-Wada R Root hair formation at the root-hypocotyl junction in CPC-LIKE MYB double and triple mutants of Arabidopsis. Plant Signal Behav, 2015. 10(11): p. e1089372 [PMID:26339713] Wada T,Tominaga-Wada R CAPRICE family genes control flowering time through both promoting and repressing CONSTANS and FLOWERING LOCUS T expression. Plant Sci., 2015. 241: p. 260-5 [PMID:26706076] Song L, et al. A transcription factor hierarchy defines an environmental stress response network. Science, 2017. [PMID:27811239] Zhou M, et al. LNK1 and LNK2 Corepressors Interact with the MYB3 Transcription Factor in Phenylpropanoid Biosynthesis. Plant Physiol., 2017. 174(3): p. 1348-1358 [PMID:28483877] Mondal SK,Roy S Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275]