![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 462967441 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
Family | ZF-HD | ||||||||
Protein Properties | Length: 76aa MW: 7208.96 Da PI: 6.2152 | ||||||||
Description | ZF-HD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | ZF-HD_dimer | 58 | 2.2e-18 | 37 | 69 | 3 | 35 |
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegee 35 +vrY+eCl+NhAa+lGgh+vDGCgEfmp g+ 462967441 37 EVRYHECLRNHAAALGGHVVDGCGEFMPGAGAG 69 79**************************86554 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04770 | 4.6E-15 | 38 | 70 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
ProDom | PD125774 | 2.0E-10 | 38 | 74 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
TIGRFAMs | TIGR01566 | 1.9E-15 | 39 | 69 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
PROSITE profile | PS51523 | 18.28 | 40 | 76 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 76 aa Download sequence Send to blast |
MGTPPAAAVP RALPPTAAAS SSSGNGAGAS AAAAPPEVRY HECLRNHAAA LGGHVVDGCG 60 EFMPGAGAGD DALKSN |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Putative transcription factor. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 462967441 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | FP096968 | 2e-34 | FP096968.1 Phyllostachys edulis cDNA clone: bphyst021i04, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025810260.1 | 4e-21 | zinc-finger homeodomain protein 6-like | ||||
Swissprot | B8AX53 | 1e-15 | ZHD6_ORYSI; Zinc-finger homeodomain protein 6 | ||||
TrEMBL | A0A2S3H9A7 | 9e-20 | A0A2S3H9A7_9POAL; Uncharacterized protein | ||||
TrEMBL | A0A2T7E9Z6 | 1e-19 | A0A2T7E9Z6_9POAL; Uncharacterized protein | ||||
STRING | Pavir.Ca01004.1.p | 9e-20 | (Panicum virgatum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP815 | 35 | 145 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G75240.1 | 6e-12 | homeobox protein 33 |