PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 462940333 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 106aa MW: 12291.2 Da PI: 8.7622 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 57.5 | 3.1e-18 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg W++eEde+l+++++ +G g+W+ ++++ g+ R++k+c++rw +yl 462940333 14 RGLWSPEEDEKLIRYITTHGYGCWSEVPEKAGLQRCGKSCRLRWINYL 61 789*******************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 9.4E-27 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 23.67 | 9 | 65 | IPR017930 | Myb domain |
SMART | SM00717 | 1.9E-12 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.0E-16 | 14 | 61 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 2.41E-22 | 16 | 88 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 4.71E-11 | 17 | 61 | No hit | No description |
PROSITE profile | PS50090 | 4.24 | 62 | 106 | IPR017877 | Myb-like domain |
Gene3D | G3DSA:1.10.10.60 | 1.3E-8 | 65 | 88 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 106 aa Download sequence Send to blast |
MGHHTCCNQQ KVKRGLWSPE EDEKLIRYIT THGYGCWSEV PEKAGLQRCG KSCRLRWINY 60 LRPDIRRGRF TAEEEKLIIS LHAIVGNRIE LLENEGLIQS NVLAKT |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 3e-13 | 14 | 88 | 7 | 80 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that regulates lignified secondary cell wall thickening of the anther endocethium, which is necessary for anther dehiscence (PubMed:12753590, PubMed:17147638, PubMed:17329564). May play a role in specifying early endothecial cell development by regulating a number of genes linked to secondary thickening such as NST1 and NST2. Acts upstream of the lignin biosynthesis pathway (PubMed:17329564). {ECO:0000269|PubMed:12753590, ECO:0000269|PubMed:17147638, ECO:0000269|PubMed:17329564}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 462940333 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Down-regulated by auxin. {ECO:0000269|PubMed:23410518}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | FP091926 | 1e-122 | FP091926.1 Phyllostachys edulis cDNA clone: bphylf039g20, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002443851.1 | 3e-63 | transcription factor MYB41 | ||||
Swissprot | Q9SPG3 | 6e-48 | MYB26_ARATH; Transcription factor MYB26 | ||||
TrEMBL | C5YGT5 | 6e-62 | C5YGT5_SORBI; Uncharacterized protein | ||||
STRING | Sb07g003320.1 | 1e-62 | (Sorghum bicolor) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP6032 | 37 | 57 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G63910.1 | 7e-61 | myb domain protein 103 |
Publications ? help Back to Top | |||
---|---|---|---|
|