PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis

Family

MIKC_MADS

Protein Properties

Length: 144aa MW: 16683.2 Da PI: 9.9748

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
462927341	genome	Tef	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	101.5	3e-32	9	58	1	50
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krienk+nrqvtfskRrng+lKKA+ELSvLCdaeva+iifss+gklye+ 462927341 9 KRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFG 58 79**********************************************95 PP
2	K-box	77.9	2.5e-26	77	141	5	69
K-box 5 sgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskK 69 ++ ++ ++++s++qe++kL+++ e Lqr+qRhllGedL++Ls+keLqqLe+qLe +l++ R++K 462927341 77 QDANNPLSESQSWYQEMSKLRAKFEALQRTQRHLLGEDLGPLSVKELQQLEKQLECALSQARQRK 141 4444566778******************************************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	33.571	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	1.8E-41	1	60	IPR002100	Transcription factor, MADS-box
CDD	cd00265	4.22E-44	2	78	No hit	No description
SuperFamily	SSF55455	5.23E-34	2	81	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.2E-33	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.1E-27	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.2E-33	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.2E-33	38	59	IPR002100	Transcription factor, MADS-box
Pfam	PF01486	1.1E-21	84	141	IPR002487	Transcription factor, K-box
PROSITE profile	PS51297	12.813	86	144	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 144 aa Download sequence Send to blast
MGRGRVELKR IENKINRQVT FSKRRNGLLK KAYELSVLCD AEVALIIFSS RGKLYEFGSA 60 GITKTLERYQ HCCYNAQDAN NPLSESQSWY QEMSKLRAKF EALQRTQRHL LGEDLGPLSV 120 KELQQLEKQL ECALSQARQR KVYI

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	2e-22	1	69	1	69	MEF2C
5f28_B	2e-22	1	69	1	69	MEF2C
5f28_C	2e-22	1	69	1	69	MEF2C
5f28_D	2e-22	1	69	1	69	MEF2C
6byy_A	2e-22	1	69	1	69	MEF2 CHIMERA
6byy_B	2e-22	1	69	1	69	MEF2 CHIMERA
6byy_C	2e-22	1	69	1	69	MEF2 CHIMERA
6byy_D	2e-22	1	69	1	69	MEF2 CHIMERA
6bz1_A	3e-22	1	69	1	69	MEF2 CHIMERA
6bz1_B	3e-22	1	69	1	69	MEF2 CHIMERA
6bz1_C	3e-22	1	69	1	69	MEF2 CHIMERA
6bz1_D	3e-22	1	69	1	69	MEF2 CHIMERA
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor. Regulates floral organ identity and floral meristem determinacy. May be involved in the control of flowering time. {ECO:0000269\|PubMed:19820190, ECO:0000269\|Ref.8}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	462927341

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	MZEMADSB	1e-176	L46398.1 Zea mays MADS-box protein (ZAG5) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015688949.1	2e-96	PREDICTED: MADS-box transcription factor 6
Swissprot	Q6EU39	5e-97	MADS6_ORYSJ; MADS-box transcription factor 6
TrEMBL	A0A0E0K3N4	7e-95	A0A0E0K3N4_ORYPU; Uncharacterized protein
TrEMBL	J3LFW7	9e-95	J3LFW7_ORYBR; Uncharacterized protein
STRING	OB02G35340.1	1e-95	(Oryza brachyantha)
STRING	OPUNC02G25740.1	1e-95	(Oryza punctata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP4187	35	66

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G45650.1	5e-71	AGAMOUS-like 6

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Li H, et al. The AGL6-like gene OsMADS6 regulates floral organ and meristem identities in rice. Cell Res., 2010. 20(3): p. 299-313 [PMID:20038961] Zhang J,Nallamilli BR,Mujahid H,Peng Z OsMADS6 plays an essential role in endosperm nutrient accumulation and is subject to epigenetic regulation in rice (Oryza sativa). Plant J., 2010. 64(4): p. 604-17 [PMID:20822505] Seok HY, et al. Rice ternary MADS protein complexes containing class B MADS heterodimer. Biochem. Biophys. Res. Commun., 2010. 401(4): p. 598-604 [PMID:20888318] Li H, et al. Rice MADS6 interacts with the floral homeotic genes SUPERWOMAN1, MADS3, MADS58, MADS13, and DROOPING LEAF in specifying floral organ identities and meristem fate. Plant Cell, 2011. 23(7): p. 2536-52 [PMID:21784949] Yadav SR,Khanday I,Majhi BB,Veluthambi K,Vijayraghavan U Auxin-responsive OsMGH3, a common downstream target of OsMADS1 and OsMADS6, controls rice floret fertility. Plant Cell Physiol., 2011. 52(12): p. 2123-35 [PMID:22016342] Duan Y, et al. Characterization of Osmads6-5, a null allele, reveals that OsMADS6 is a critical regulator for early flower development in rice (Oryza sativa L.). Plant Mol. Biol., 2012. 80(4-5): p. 429-42 [PMID:22933119] Conrad LJ, et al. The polycomb group gene EMF2B is essential for maintenance of floral meristem determinacy in rice. Plant J., 2014. 80(5): p. 883-94 [PMID:25279942] Zhang J, et al. Down-regulation of a LBD-like gene, OsIG1, leads to occurrence of unusual double ovules and developmental abnormalities of various floral organs and megagametophyte in rice. J. Exp. Bot., 2015. 66(1): p. 99-112 [PMID:25324400] Bai X, et al. Regulatory role of FZP in the determination of panicle branching and spikelet formation in rice. Sci Rep, 2016. 6: p. 19022 [PMID:26744119] Zhang B, et al. A High Temperature-Dependent Mitochondrial Lipase EXTRA GLUME1 Promotes Floral Phenotypic Robustness against Temperature Fluctuation in Rice (Oryza sativa L.). PLoS Genet., 2016. 12(7): p. e1006152 [PMID:27367609]