![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 462924093 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 186aa MW: 19349.8 Da PI: 8.5828 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 59.7 | 7.9e-19 | 37 | 77 | 1 | 41 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasn 41 +CaaCk+lrrkC++dCv+apyfp ++p+kf vh++FGasn 462924093 37 PCAACKFLRRKCQPDCVFAPYFPPDNPQKFVHVHRVFGASN 77 7**************************************98 PP | |||||||
2 | DUF260 | 29.5 | 2e-09 | 77 | 112 | 64 | 99 |
DUF260 64 eAearardPvyGavgvilklqqqleqlkaelallke 99 +A++r+rdPvyG+vgvi+ lq++l+ql+++la++k 462924093 77 NADMRLRDPVYGCVGVISILQHNLRQLQQDLARAKY 112 69*****************************99876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 12.705 | 36 | 135 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 9.6E-18 | 37 | 77 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 3.8E-7 | 77 | 110 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 186 aa Download sequence Send to blast |
MASSSASSMP APSGSVITVA TSSSSAAAAA VCGTGSPCAA CKFLRRKCQP DCVFAPYFPP 60 DNPQKFVHVH RVFGASNADM RLRDPVYGCV GVISILQHNL RQLQQDLARA KYELSKYQDQ 120 FASAQMLSRS YDGEPIARLG INGGYEFGYS TSMGGAGPVS GLGTLGLSPF LKSGTAGGDE 180 KPSAGQ |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 3e-34 | 27 | 117 | 1 | 114 | LOB family transfactor Ramosa2.1 |
5ly0_B | 3e-34 | 27 | 117 | 1 | 114 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Promotes the switch from proliferation to differentiation in the embryo sac. Negative regulator of cell proliferation in the adaxial side of leaves. Regulates the formation of a symmetric lamina and the establishment of venation. Interacts directly with RS2 (rough sheath 2) to repress some knox homeobox genes. {ECO:0000269|PubMed:17209126}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 462924093 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY940681 | 3e-66 | AY940681.1 Zea mays ASYMMETRIC LEAVES2 mRNA, complete cds. | |||
GenBank | EF081454 | 3e-66 | EF081454.1 Zea mays indeterminate gametophyte 1 (IG1) gene, complete cds. | |||
GenBank | EU964817 | 3e-66 | EU964817.1 Zea mays clone 281759 mRNA sequence. | |||
GenBank | EU966092 | 3e-66 | EU966092.1 Zea mays clone 291632 mRNA sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001105838.1 | 1e-98 | LOB domain-containing protein 6 | ||||
Refseq | XP_008673456.1 | 1e-98 | LOB domain-containing protein 6 isoform X1 | ||||
Refseq | XP_020405662.1 | 1e-98 | LOB domain-containing protein 6 isoform X1 | ||||
Swissprot | Q32SG3 | 1e-99 | LBD6_MAIZE; LOB domain-containing protein 6 | ||||
TrEMBL | A0A2T7DDD6 | 1e-104 | A0A2T7DDD6_9POAL; Uncharacterized protein | ||||
TrEMBL | A0A3L6RGB0 | 1e-104 | A0A3L6RGB0_PANMI; LOB domain-containing protein 6 | ||||
STRING | GRMZM2G118250_P06 | 4e-98 | (Zea mays) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2267 | 38 | 95 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G66870.1 | 8e-37 | ASYMMETRIC LEAVES 2-like 1 |