PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 462920631 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 160aa MW: 18190.7 Da PI: 10.3634 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 49.9 | 6.7e-16 | 90 | 139 | 5 | 55 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 +r++r++kNRe+A rsR+RK+a++ eLe+kv Le+eN++Lk + +el+k+ 462920631 90 RRQKRMIKNRESAARSRARKQAYTNELENKVSRLEEENERLK-RQKELEKM 139 79***************************************9.88888887 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.20.5.170 | 2.8E-15 | 84 | 138 | No hit | No description |
SMART | SM00338 | 7.6E-11 | 86 | 154 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 11.702 | 88 | 133 | IPR004827 | Basic-leucine zipper domain |
CDD | cd14707 | 2.57E-23 | 90 | 144 | No hit | No description |
SuperFamily | SSF57959 | 1.44E-11 | 90 | 135 | No hit | No description |
Pfam | PF00170 | 2.8E-13 | 90 | 138 | IPR004827 | Basic-leucine zipper domain |
PROSITE pattern | PS00036 | 0 | 93 | 108 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 160 aa Download sequence Send to blast |
MTRGAQWLDP YQQQFTAIDP HQHVQQSMPV AYMPSRLALQ PLNVGPCAIM EPAYSDGNNT 60 SPMMGALSDS PTPGRKRGAS GDVADKLMER RQKRMIKNRE SAARSRARKQ AYTNELENKV 120 SRLEEENERL KRQKELEKML FSAPLPEPKY QLRRTGSAAF |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Binds to the embryo specification element and the ABA-responsive element (ABRE) of the Dc3 gene promoter. Could participate in abscisic acid-regulated gene expression during seed development. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 462920631 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004970325.1 | 1e-94 | ABSCISIC ACID-INSENSITIVE 5-like protein 2 | ||||
Refseq | XP_022682969.1 | 1e-94 | ABSCISIC ACID-INSENSITIVE 5-like protein 2 | ||||
Swissprot | Q9LES3 | 2e-44 | AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2 | ||||
TrEMBL | A0A0A9HCS1 | 5e-96 | A0A0A9HCS1_ARUDO; Uncharacterized protein | ||||
STRING | Si002173m | 4e-94 | (Setaria italica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2707 | 38 | 83 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G56850.1 | 7e-47 | ABA-responsive element binding protein 3 |
Publications ? help Back to Top | |||
---|---|---|---|
|