PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 462905084 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
Family | HSF | ||||||||
Protein Properties | Length: 221aa MW: 25341.7 Da PI: 7.9757 | ||||||||
Description | HSF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HSF_DNA-bind | 86.7 | 3.2e-27 | 12 | 82 | 2 | 72 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTEEE---SSBTT CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgFkkvkdeekks 72 Fl+k+++++ d++++ ++sw + gnsf+v+d++ fa +Lp++Fkh+nf+SFvRQLn+YgF+k++ +++++ 462905084 12 FLTKTFDLVADPATDGVVSWGRAGNSFIVWDPHVFAAVLLPRFFKHNNFSSFVRQLNTYGFRKIDPDRRRR 82 9***************************************************************9998764 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00415 | 3.3E-35 | 8 | 130 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Gene3D | G3DSA:1.10.10.10 | 3.0E-29 | 8 | 83 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SuperFamily | SSF46785 | 8.71E-26 | 10 | 79 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
PRINTS | PR00056 | 5.7E-19 | 12 | 35 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Pfam | PF00447 | 1.9E-24 | 12 | 99 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 5.7E-19 | 50 | 62 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PROSITE pattern | PS00434 | 0 | 51 | 75 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 5.7E-19 | 63 | 75 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 221 aa Download sequence Send to blast |
MEGLHEVGPP PFLTKTFDLV ADPATDGVVS WGRAGNSFIV WDPHVFAAVL LPRFFKHNNF 60 SSFVRQLNTY GFRKIDPDRR RRPPSYLPAS QQQQALGTYL EVGHFGGLDE EIDRLKRDKN 120 ILLAEVVKLR QEQQSTKADM QAMEERLQHA ESKQLQMMGF LARAMQNPDF FHQLLQHQDR 180 RRELEDAFSK KRRRPIDIVP FAAGAGAAAA ETRRQGEEEL D |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2ldu_A | 1e-21 | 10 | 75 | 18 | 83 | Heat shock factor protein 1 |
5hdg_A | 1e-21 | 10 | 75 | 8 | 73 | Heat shock factor protein 1 |
5hdn_A | 1e-21 | 10 | 75 | 8 | 73 | Heat shock factor protein 1 |
5hdn_B | 1e-21 | 10 | 75 | 8 | 73 | Heat shock factor protein 1 |
5hdn_C | 1e-21 | 10 | 75 | 8 | 73 | Heat shock factor protein 1 |
5hdn_D | 1e-21 | 10 | 75 | 8 | 73 | Heat shock factor protein 1 |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 179 | 193 | RRRELEDAFSKKRRR |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 462905084 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By heat stress. {ECO:0000269|PubMed:18064488}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | CP012611 | 8e-83 | CP012611.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 3 sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004985605.1 | 1e-122 | heat stress transcription factor A-2d | ||||
Swissprot | Q8H7Y6 | 1e-119 | HFA2D_ORYSJ; Heat stress transcription factor A-2d | ||||
TrEMBL | A0A1E5WLF6 | 1e-126 | A0A1E5WLF6_9POAL; Heat stress transcription factor A-2d | ||||
STRING | Si038907m | 1e-122 | (Setaria italica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP308 | 37 | 231 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G22830.1 | 1e-75 | heat shock transcription factor A6B |