![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 462893456 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
Family | B3 | ||||||||
Protein Properties | Length: 90aa MW: 10343 Da PI: 8.6164 | ||||||||
Description | B3 family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | B3 | 54 | 3e-17 | 14 | 79 | 31 | 98 |
.--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS B3 31 eesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 + + ++tl d++g+sWev + y+k+sg+ ++ +GW Fv n+++ D+++F++ ++++++v+vfr 462893456 14 KANAKVTLWDPQGKSWEVCYMYSKSSGGAYFCRGWGAFVVGNNIEKDDICIFYFF--KKKNMKVGVFR 79 34569************************************************75..577789**998 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM01019 | 4.9E-4 | 1 | 81 | IPR003340 | B3 DNA binding domain |
PROSITE profile | PS50863 | 13.239 | 1 | 81 | IPR003340 | B3 DNA binding domain |
CDD | cd10017 | 7.15E-18 | 1 | 79 | No hit | No description |
Gene3D | G3DSA:2.40.330.10 | 4.1E-19 | 2 | 79 | IPR015300 | DNA-binding pseudobarrel domain |
SuperFamily | SSF101936 | 1.49E-20 | 2 | 79 | IPR015300 | DNA-binding pseudobarrel domain |
Pfam | PF02362 | 4.9E-15 | 4 | 79 | IPR003340 | B3 DNA binding domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 90 aa Download sequence Send to blast |
MEFPSDIVMK YLPKANAKVT LWDPQGKSWE VCYMYSKSSG GAYFCRGWGA FVVGNNIEKD 60 DICIFYFFKK KNMKVGVFRV LQETTPSSEC |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 462893456 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021316377.1 | 8e-24 | B3 domain-containing protein Os11g0197600 isoform X1 | ||||
Refseq | XP_021316378.1 | 8e-24 | B3 domain-containing protein Os11g0197600 isoform X1 | ||||
TrEMBL | A0A0A9NR78 | 4e-23 | A0A0A9NR78_ARUDO; Uncharacterized protein |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP4461 | 37 | 66 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G18990.1 | 1e-07 | B3 family protein |