 |
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
462890926 |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
Family |
WRKY |
Protein Properties |
Length: 103aa MW: 12075.8 Da PI: 10.5843 |
Description |
WRKY family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
462890926 | genome | Tef | View CDS |
|
Signature Domain? help Back to Top |
 |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | WRKY | 107.9 | 4.9e-34 | 23 | 81 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
ldDgy+WrKYGqK vk+s fprsYYrCt+++C+vkk+v+r a+d+++v++tYeg Hnh+
462890926 23 LDDGYRWRKYGQKAVKNSAFPRSYYRCTHHTCNVKKQVQRLAKDTSIVVTTYEGVHNHP 81
59********************************************************8 PP
|
Gene Ontology ? help Back to Top |
GO Term |
GO Category |
GO Description |
GO:0006355 | Biological Process | regulation of transcription, DNA-templated |
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Annotation --
Nucleotide ? help
Back to Top |
Source |
Hit ID |
E-value |
Description |
GenBank | DQ840412 | 1e-104 | DQ840412.1 Hordeum vulgare subsp. vulgare WRKY transcription factor 13 (WRKY13) mRNA, partial cds. |