 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
462874425 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
| Family |
BES1 |
| Protein Properties |
Length: 125aa MW: 13233 Da PI: 10.5338 |
| Description |
BES1 family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| 462874425 | genome | Tef | View CDS |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | DUF822 | 153.3 | 1.8e-47 | 25 | 98 | 3 | 76 |
DUF822 3 sgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpl 76
r p+wkErEnn+ RERrRRaiaaki+ GLRa Gny+lpk++DnneVlkALc+eAGw+ve+DGttyrk sk
462874425 25 PVRVPSWKERENNRNRERRRRAIAAKIFGGLRAFGNYRLPKHCDNNEVLKALCKEAGWTVEPDGTTYRKVSKTA 98
5699****************************************************************998865 PP
|
| 3D Structure ? help Back to Top |
 |
| PDB ID |
Evalue |
Query Start |
Query End |
Hit Start |
Hit End |
Description |
| 5zd4_A | 3e-21 | 27 | 96 | 372 | 441 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
| 5zd4_B | 3e-21 | 27 | 96 | 372 | 441 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
| 5zd4_C | 3e-21 | 27 | 96 | 372 | 441 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
| 5zd4_D | 3e-21 | 27 | 96 | 372 | 441 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
| Search in ModeBase |
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | May function in brassinosteroid signaling. {ECO:0000250}. |
