![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 462873395 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
Family | ARR-B | ||||||||
Protein Properties | Length: 232aa MW: 26509.4 Da PI: 6.6514 | ||||||||
Description | ARR-B family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | G2-like | 66.5 | 4.7e-21 | 180 | 229 | 1 | 51 |
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 k+r++W +LH+ Fve+v++L G++k +Pk+i+e m+v+g+t++hv+SHLQ 462873395 180 KQRVQWFGQLHRIFVEVVHRL-GIDKVVPKKIVEEMNVEGITRDHVASHLQ 229 79*******************.***************************** PP | |||||||
2 | Response_reg | 74.8 | 3.1e-25 | 12 | 122 | 1 | 108 |
EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH.....ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHT CS Response_reg 1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd.....pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealka 92 vl vdD+ + ++l+++ l++ +y +v+++ +++ ale+l++++ +Dl+++D+ mp+md+++ll+ i e ++p+i+++a+++ e++ + +k 462873395 12 VLAVDDDSVSLMLIEKQLQHFKY-KVTAVNHAKTALEMLRARRdaedqFDLVITDVHMPDMDAFKLLELIGLEI-DIPVIMLSANDKLETMMKGIKH 106 799********************.***************888888889**********************7666.7********************* PP TESEEEESS--HHHHH CS Response_reg 93 GakdflsKpfdpeelv 108 Ga +l+Kp+ e+l 462873395 107 GACNYLVKPVCLEQLE 122 **********999986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:3.40.50.2300 | 1.3E-36 | 9 | 161 | No hit | No description |
SuperFamily | SSF52172 | 3.7E-31 | 9 | 129 | IPR011006 | CheY-like superfamily |
SMART | SM00448 | 9.0E-27 | 10 | 125 | IPR001789 | Signal transduction response regulator, receiver domain |
PROSITE profile | PS50110 | 38.029 | 11 | 129 | IPR001789 | Signal transduction response regulator, receiver domain |
Pfam | PF00072 | 3.6E-21 | 12 | 122 | IPR001789 | Signal transduction response regulator, receiver domain |
CDD | cd00156 | 1.28E-23 | 13 | 121 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 9.4E-20 | 178 | 229 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 2.15E-12 | 179 | 229 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 6.7E-20 | 180 | 229 | IPR006447 | Myb domain, plants |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0000160 | Biological Process | phosphorelay signal transduction system | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 232 aa Download sequence Send to blast |
MDLNELRAKM HVLAVDDDSV SLMLIEKQLQ HFKYKVTAVN HAKTALEMLR ARRDAEDQFD 60 LVITDVHMPD MDAFKLLELI GLEIDIPVIM LSANDKLETM MKGIKHGACN YLVKPVCLEQ 120 LENLWIHVVV QNTNDPSISI NNYDDGHHQS QSEDSDNGNV PNQTISKSSR KKKKKDGTKK 180 QRVQWFGQLH RIFVEVVHRL GIDKVVPKKI VEEMNVEGIT RDHVASHLQD ST |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 169 | 175 | RKKKKKD |
2 | 170 | 179 | KKKKKDGTKK |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins (By similarity). Functions as a response regulator in response to cytokinins (PubMed:22383541). {ECO:0000250|UniProtKB:Q940D0, ECO:0000269|PubMed:22383541}. | |||||
UniProt | Transcriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 462873395 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025812920.1 | 3e-82 | two-component response regulator ORR25-like isoform X1 | ||||
Refseq | XP_025812922.1 | 3e-82 | two-component response regulator ORR24-like isoform X2 | ||||
Swissprot | B8B3I4 | 2e-65 | ORR22_ORYSI; Two-component response regulator ORR22 | ||||
Swissprot | Q5SML5 | 2e-65 | ORR22_ORYSJ; Two-component response regulator ORR22 | ||||
TrEMBL | A0A2S3HI73 | 2e-81 | A0A2S3HI73_9POAL; Uncharacterized protein | ||||
STRING | Si007844m | 8e-82 | (Setaria italica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP12043 | 4 | 6 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G25180.1 | 2e-59 | response regulator 12 |
Publications ? help Back to Top | |||
---|---|---|---|
|