![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 462868440 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
Family | HSF | ||||||||
Protein Properties | Length: 116aa MW: 12642.4 Da PI: 10.0309 | ||||||||
Description | HSF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HSF_DNA-bind | 79.5 | 5.4e-25 | 24 | 84 | 2 | 62 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTE CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgF 62 Fl+k+++++e+++++e+isw e+g+sfvv+++ efa+++Lp +Fkhsnf+SFvRQLn+Y+ 462868440 24 FLTKTHQMVEERATDEVISWAEQGRSFVVWKPVEFARDLLPLHFKHSNFSSFVRQLNTYNL 84 9**********************************************************86 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.10 | 1.0E-26 | 19 | 84 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SMART | SM00415 | 4.0E-21 | 20 | 110 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
SuperFamily | SSF46785 | 7.35E-23 | 20 | 88 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
PRINTS | PR00056 | 1.3E-14 | 24 | 47 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Pfam | PF00447 | 1.9E-21 | 24 | 86 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 1.3E-14 | 62 | 74 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 1.3E-14 | 75 | 87 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 116 aa Download sequence Send to blast |
MATAAAGQPA KAGGRGGGGG PAPFLTKTHQ MVEERATDEV ISWAEQGRSF VVWKPVEFAR 60 DLLPLHFKHS NFSSFVRQLN TYNLAEPPLV TTSGRAHMFH CSFLLRVGSL FTNLNA |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1hks_A | 3e-16 | 17 | 94 | 1 | 77 | HEAT-SHOCK TRANSCRIPTION FACTOR |
1hkt_A | 3e-16 | 17 | 94 | 1 | 77 | HEAT-SHOCK TRANSCRIPTION FACTOR |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 12 | 19 | GGRGGGGG |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 462868440 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KJ727754 | 2e-85 | KJ727754.1 Zea mays clone pUT5697 HSF transcription factor (HSF21) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001150318.1 | 3e-40 | uncharacterized protein LOC100283948 | ||||
Swissprot | Q67TP9 | 7e-35 | HSFB1_ORYSJ; Heat stress transcription factor B-1 | ||||
TrEMBL | B6TNF2 | 8e-39 | B6TNF2_MAIZE; Heat shock factor protein 4 | ||||
STRING | GRMZM2G139535_P02 | 4e-38 | (Zea mays) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP121 | 37 | 394 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G11660.1 | 5e-27 | HSF family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|