![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 462851070 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 102aa MW: 11208.3 Da PI: 8.4688 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 58.7 | 1.1e-18 | 33 | 75 | 2 | 44 |
--SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSS CS WRKY 2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaed 44 +Dgy+W+KYGqK +k+ + +rsY+rC +++C +kkkve +d 462851070 33 EDGYEWKKYGQKFIKNIQKTRSYFRCRHKRCGAKKKVEWHPSD 75 7*************************************98877 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 1.0E-19 | 21 | 76 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 15.847 | 27 | 75 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 6.67E-18 | 28 | 76 | IPR003657 | WRKY domain |
SMART | SM00774 | 6.0E-14 | 32 | 89 | IPR003657 | WRKY domain |
Pfam | PF03106 | 1.1E-16 | 33 | 75 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 102 aa Download sequence Send to blast |
MASTSHPAPK CEGEESTETA AETSNGSQIV MPEDGYEWKK YGQKFIKNIQ KTRSYFRCRH 60 KRCGAKKKVE WHPSDADGDG GGTANQYELG AQYFGGGGAR SQ |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 462851070 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU970633 | 1e-52 | EU970633.1 Zea mays clone 348246 hypothetical protein mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004986337.2 | 9e-38 | probable WRKY transcription factor 71 | ||||
TrEMBL | A0A368SIG9 | 2e-36 | A0A368SIG9_SETIT; Uncharacterized protein | ||||
STRING | BRADI1G13207.1 | 1e-33 | (Brachypodium distachyon) | ||||
STRING | Si038001m | 1e-33 | (Setaria italica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP10158 | 34 | 44 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G39410.1 | 4e-12 | WRKY DNA-binding protein 13 |