PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 462848999 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
Family | B3 | ||||||||
Protein Properties | Length: 137aa MW: 15052.5 Da PI: 10.8537 | ||||||||
Description | B3 family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | B3 | 62 | 9.8e-20 | 6 | 70 | 33 | 99 |
-SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS B3 33 sktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 ++t+ +d +g++W++++iyr++++r++lt+GW+ Fv++++L +gD++vF +++ +el+v+++r+ 462848999 6 TTTVLAKDVHGEVWKFRHIYRGTPRRHLLTTGWSTFVNQKKLVAGDSIVFL--RTELGELCVGIRRA 70 568999*********************************************..559999******97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
CDD | cd10017 | 6.48E-15 | 1 | 69 | No hit | No description |
PROSITE profile | PS50863 | 12.689 | 1 | 71 | IPR003340 | B3 DNA binding domain |
SuperFamily | SSF101936 | 1.57E-18 | 5 | 72 | IPR015300 | DNA-binding pseudobarrel domain |
SMART | SM01019 | 0.0021 | 6 | 71 | IPR003340 | B3 DNA binding domain |
Pfam | PF02362 | 1.5E-17 | 6 | 70 | IPR003340 | B3 DNA binding domain |
Gene3D | G3DSA:2.40.330.10 | 2.5E-22 | 6 | 73 | IPR015300 | DNA-binding pseudobarrel domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 137 aa Download sequence Send to blast |
MGGGGTTTVL AKDVHGEVWK FRHIYRGTPR RHLLTTGWST FVNQKKLVAG DSIVFLRTEL 60 GELCVGIRRA KRVSCGGMEC MSGWNAPGYG GFSPFLKEEE SKLMKGPGGY MRGRGKVKIA 120 DVVDAASLAA RRAYRMR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4ldu_A | 7e-22 | 6 | 72 | 195 | 261 | Auxin response factor 5 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Auxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 462848999 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT060467 | 1e-110 | BT060467.1 Zea mays full-length cDNA clone ZM_BFb0003E21 mRNA, complete cds. | |||
GenBank | EU967025 | 1e-110 | EU967025.1 Zea mays clone 298928 mRNA sequence. | |||
GenBank | HM004517 | 1e-110 | HM004517.1 Zea mays auxin response factor 2 (ARF2) gene, complete cds. | |||
GenBank | JX428504 | 1e-110 | JX428504.1 Zea mays subsp. mays clone pUT3102 ARF2 ARF type transcription factor mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004982839.1 | 7e-76 | auxin response factor 22 | ||||
Swissprot | Q9AV47 | 2e-61 | ARFV_ORYSJ; Auxin response factor 22 | ||||
TrEMBL | A0A1E5UWA3 | 2e-75 | A0A1E5UWA3_9POAL; Auxin response factor | ||||
STRING | Si034525m | 3e-75 | (Setaria italica) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G30080.1 | 8e-47 | auxin response factor 16 |
Publications ? help Back to Top | |||
---|---|---|---|
|