PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 442185 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 122aa MW: 13411.1 Da PI: 5.2374 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 171 | 1.3e-53 | 26 | 114 | 1 | 89 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkk 89 v+eq+rflPianvsrimkkvlP+nakiskdaketvqecvsefisf+t+easdkc+rekrktingddllwa++tlGfedy++plk+yl++ 442185 26 VKEQERFLPIANVSRIMKKVLPGNAKISKDAKETVQECVSEFISFITGEASDKCKREKRKTINGDDLLWAMGTLGFEDYIDPLKLYLQR 114 589************************************************************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 5.8E-49 | 24 | 114 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.46E-36 | 29 | 114 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.3E-28 | 32 | 96 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.6E-17 | 60 | 78 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 63 | 79 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.6E-17 | 79 | 97 | No hit | No description |
PRINTS | PR00615 | 1.6E-17 | 98 | 116 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 122 aa Download sequence Send to blast |
MADYPGTPES SPHSDNESGG GNYSSVKEQE RFLPIANVSR IMKKVLPGNA KISKDAKETV 60 QECVSEFISF ITGEASDKCK REKRKTINGD DLLWAMGTLG FEDYIDPLKL YLQRGYAISS 120 L* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_A | 3e-47 | 21 | 114 | 1 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU019900 | 1e-167 | Selaginella moellendorffii CCAAT-box binding factor HAP3-like protein (HAP3B1) mRNA, partial cds |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002973728.1 | 2e-81 | nuclear transcription factor Y subunit B-3 | ||||
Refseq | XP_002975778.1 | 2e-81 | nuclear transcription factor Y subunit B-1 | ||||
Swissprot | Q69J40 | 5e-61 | NFYBA_ORYSJ; Nuclear transcription factor Y subunit B-10 | ||||
TrEMBL | D8RRF4 | 4e-80 | D8RRF4_SELML; CCAAT-box binding factor HAP3-like protein | ||||
TrEMBL | D8RXB7 | 4e-80 | D8RXB7_SELML; CCAAT-box binding factor HAP3-like protein | ||||
STRING | EFJ23407 | 6e-81 | (Selaginella moellendorffii) | ||||
STRING | EFJ25388 | 6e-81 | (Selaginella moellendorffii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP168 | 17 | 170 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G14540.1 | 4e-61 | nuclear factor Y, subunit B3 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 442185 |
Publications ? help Back to Top | |||
---|---|---|---|
|