![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 43387 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Bathycoccaceae; Ostreococcus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 115aa MW: 13715.4 Da PI: 9.7654 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 57.9 | 2.3e-18 | 23 | 68 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 r rW++eEde+l+ + +++G++ W+tIar+mg gRt+ qc rw+ +l 43387 23 RERWSEEEDEKLKTLKERYGSR-WATIAREMG-GRTDQQCMGRWRRHL 68 78********************.*********.************986 PP | |||||||
2 | Myb_DNA-binding | 39.2 | 1.6e-12 | 74 | 115 | 1 | 44 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 rg+W +Edell + ++G++ W+ I + ++ gRt+ qc+ rw 43387 74 RGAWARDEDELLCGLYDEYGPR-WSFICQSVP-GRTAQQCRARW 115 89******************99.*********.**********9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 9.8E-5 | 1 | 26 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 7.54 | 1 | 17 | IPR017930 | Myb domain |
PROSITE profile | PS51294 | 24.324 | 18 | 72 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 4.4E-26 | 20 | 115 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 4.1E-16 | 22 | 70 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 4.07E-12 | 25 | 68 | No hit | No description |
Pfam | PF13921 | 1.2E-17 | 26 | 85 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 6.4E-23 | 27 | 76 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 0.0025 | 73 | 115 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 17.426 | 73 | 115 | IPR017930 | Myb domain |
CDD | cd00167 | 8.05E-7 | 76 | 115 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 2.3E-15 | 77 | 115 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 115 aa Download sequence Send to blast |
MGTRSGQQCA QRWRHKVNPG IRRERWSEEE DEKLKTLKER YGSRWATIAR EMGGRTDQQC 60 MGRWRRHLDP TVTRGAWARD EDELLCGLYD EYGPRWSFIC QSVPGRTAQQ CRARW |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h88_C | 8e-24 | 1 | 115 | 6 | 151 | MYB PROTO-ONCOGENE PROTEIN |
1h89_C | 8e-24 | 1 | 115 | 6 | 151 | MYB PROTO-ONCOGENE PROTEIN |
Search in ModeBase |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | CP000594 | 1e-136 | CP000594.1 Ostreococcus lucimarinus CCE9901 chromosome 14, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_001421243.1 | 9e-82 | predicted protein | ||||
TrEMBL | A4S7B6 | 2e-80 | A4S7B6_OSTLU; Uncharacterized protein | ||||
STRING | ABO99536 | 4e-81 | (Ostreococcus 'lucimarinus') |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Chlorophytae | OGCP15 | 16 | 114 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G11510.1 | 1e-21 | myb domain protein 3r-4 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 43387 |