![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 38104 | ||||||||
Common Name | HAP3A1, SELMODRAFT_450072, SmHAP3A-1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 115aa MW: 12824.5 Da PI: 7.259 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 185.2 | 5.1e-58 | 12 | 107 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 reqdrflPianvsrimk+ lP+nakiskdaketvqecvsefisfvt+easdkcqrekrktingddllwa++tlGfedyvepl+vyl+kyre egek 38104 12 REQDRFLPIANVSRIMKRGLPGNAKISKDAKETVQECVSEFISFVTGEASDKCQREKRKTINGDDLLWAMSTLGFEDYVEPLRVYLHKYREQEGEK 107 89*******************************************************************************************997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 4.1E-53 | 10 | 108 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 2.17E-40 | 14 | 107 | IPR009072 | Histone-fold |
Pfam | PF00808 | 5.2E-28 | 17 | 81 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.4E-21 | 45 | 63 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 48 | 64 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.4E-21 | 64 | 82 | No hit | No description |
PRINTS | PR00615 | 1.4E-21 | 83 | 101 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 115 aa Download sequence Send to blast |
GGGGNLSSLS PREQDRFLPI ANVSRIMKRG LPGNAKISKD AKETVQECVS EFISFVTGEA 60 SDKCQREKRK TINGDDLLWA MSTLGFEDYV EPLRVYLHKY REQEGEKAML AKAGE |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_A | 6e-51 | 7 | 102 | 2 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. {ECO:0000250}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU019899 | 0.0 | Selaginella moellendorffii CCAAT-box binding factor HAP3-like protein (HAP3A2) mRNA, partial cds |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002967268.1 | 6e-81 | nuclear transcription factor Y subunit B-8 | ||||
Swissprot | Q75IZ7 | 1e-64 | NFYB8_ORYSJ; Nuclear transcription factor Y subunit B-8 | ||||
TrEMBL | D8QMV1 | 1e-79 | D8QMV1_SELML; CCAAT-box binding factor HAP3-like protein | ||||
TrEMBL | D8R7C9 | 1e-79 | D8R7C9_SELML; CCAAT-box binding factor HAP3-like protein | ||||
STRING | EFJ31867 | 2e-80 | (Selaginella moellendorffii) | ||||
STRING | EFJ37991 | 3e-80 | (Selaginella moellendorffii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP168 | 17 | 170 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G14540.1 | 3e-66 | nuclear factor Y, subunit B3 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 38104 |
Entrez Gene | 9641987 |
Publications ? help Back to Top | |||
---|---|---|---|
|