PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella

Family

G2-like

Protein Properties

Length: 133aa MW: 15316.8 Da PI: 10.6934

Description

G2-like family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
35907	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	G2-like	109.6	1.6e-34	7	61	1	55
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 kprlrWtpeLHerFveav+qLGG+ekAtPk+++++m+vkgLtl+h+kSHLQk+Rl 35907 7 KPRLRWTPELHERFVEAVTQLGGAEKATPKSVMRIMGVKGLTLYHLKSHLQKFRL 61 79****************************************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	12.009	4	64	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	2.0E-33	5	62	IPR009057	Homeodomain-like
SuperFamily	SSF46689	1.34E-17	6	62	IPR009057	Homeodomain-like
TIGRFAMs	TIGR01557	2.1E-24	7	62	IPR006447	Myb domain, plants
Pfam	PF00249	5.4E-9	9	59	IPR001005	SANT/Myb domain
Pfam	PF14379	6.6E-26	85	131	IPR025756	MYB-CC type transcription factor, LHEQLE-containing domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 133 aa Download sequence Send to blast
ISASEPKPRL RWTPELHERF VEAVTQLGGA EKATPKSVMR IMGVKGLTLY HLKSHLQKFR 60 LGKQLNKDTN VANRNACPHH FASSQITEAL RLQMEVQKKL HEQLEVQRHL QLRIEAQGKY 120 LQALLEKARE TFS

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6j4r_A	3e-24	7	63	1	57	Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B	3e-24	7	63	1	57	Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C	3e-24	7	63	1	57	Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D	3e-24	7	63	1	57	Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator (PubMed:26586833). Acts redundantly with PHR1 as a key component of the central regulatory system controlling transcriptional responses to Pi starvation (PubMed:26586833). Binds in a sequence-specific manner to phosphate starvation-regulated promoters (PubMed:26586833). {ECO:0000269\|PubMed:26586833}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Up-regulated in roots by low Pi. {ECO:0000269\|PubMed:26586833}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_024540307.1	5e-79	protein PHR1-LIKE 3
Swissprot	Q94A57	8e-58	PHL2_ARATH; Protein PHR1-LIKE 2
TrEMBL	D8S864	1e-92	D8S864_SELML; Uncharacterized protein (Fragment)
STRING	EFJ19363	2e-93	(Selaginella moellendorffii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP78	17	262

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G24120.1	3e-60	G2-like family protein

Link Out ? help Back to Top
Phytozome	35907
Entrez Gene	9634483

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Banks JA, et al. The Selaginella genome identifies genetic changes associated with the evolution of vascular plants. Science, 2011. 332(6032): p. 960-3 [PMID:21551031]