PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

WRKY

Protein Properties

Length: 174aa MW: 19351.2 Da PI: 6.9329

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
351629	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	101.6	4.7e-32	112	170	1	59
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDg++WrKYG+K+vk+s++pr+YY+C+ +Cpvkk+ver+++dp++v++tYeg+Hnh+ 351629 112 LDDGFKWRKYGKKMVKNSPYPRNYYKCSVDSCPVKKRVERDRDDPSFVITTYEGSHNHS 170 59********************************************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	8.3E-34	98	171	IPR003657	WRKY domain
SuperFamily	SSF118290	1.57E-28	105	170	IPR003657	WRKY domain
PROSITE profile	PS50811	29.402	107	172	IPR003657	WRKY domain
SMART	SM00774	2.1E-36	112	171	IPR003657	WRKY domain
Pfam	PF03106	2.2E-25	113	169	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009867	Biological Process	jasmonic acid mediated signaling pathway
GO:0050832	Biological Process	defense response to fungus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 174 aa Download sequence Send to blast
MNGAETNLAR SYSDDTHSGF EFPELDLSDE WMDDDLVSAV SGMNQSYGYQ TSDVAAALFS 60 GSSSSFCHPE SQRTNASVAA TATASANNQN KKEKKKVKER VAFKTRSEVE VLDDGFKWRK 120 YGKKMVKNSP YPRNYYKCSV DSCPVKKRVE RDRDDPSFVI TTYEGSHNHS SAN*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	4e-27	102	169	7	74	Probable WRKY transcription factor 4
2lex_A	4e-27	102	169	7	74	Probable WRKY transcription factor 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00531	DAP	Transfer from AT5G26170	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	351629

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AY071847	0.0	AY071847.1 Arabidopsis thaliana WRKY transcription factor 50 (WRKY50) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002874303.1	1e-127	probable WRKY transcription factor 50
Swissprot	Q8VWQ5	1e-105	WRK50_ARATH; Probable WRKY transcription factor 50
TrEMBL	D7M4P8	1e-126	D7M4P8_ARALL; WRKY DNA-binding protein 50
STRING	fgenesh1_pg.C_scaffold_6002222	1e-127	(Arabidopsis lyrata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM6121	27	47

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G26170.1	3e-93	WRKY DNA-binding protein 50

Link Out ? help Back to Top
Phytozome	351629
Entrez Gene	9308269

Publications ? help Back to Top
Brand LH,Kirchler T,Hummel S,Chaban C,Wanke D DPI-ELISA: a fast and versatile method to specify the binding of plant transcription factors to DNA in vitro. Plant Methods, 2010. 6: p. 25 [PMID:21108821]