 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
327672 |
| Common Name | ARALYDRAFT_327672 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
| Family |
MYB_related |
| Protein Properties |
Length: 80aa MW: 9205.46 Da PI: 5.7376 |
| Description |
MYB_related family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| 327672 | genome | JGI | View CDS |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | Myb_DNA-binding | 31.2 | 5.1e-10 | 34 | 74 | 3 | 45 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
++++eE++l + +k+ G + W++Ia +++ gRt+ ++ +w
327672 34 NMSQEEEDLVCRMHKLVGDR-WELIAGRIP-GRTAGEIERFWM 74
689***************99.*********.**********97 PP
|
| Gene Ontology ? help Back to Top |
| GO Term |
GO Category |
GO Description |
| GO:0009651 | Biological Process | response to salt stress |
| GO:0009737 | Biological Process | response to abscisic acid |
| GO:0009751 | Biological Process | response to salicylic acid |
| GO:0009753 | Biological Process | response to jasmonic acid |
| GO:0010026 | Biological Process | trichome differentiation |
| GO:0010228 | Biological Process | vegetative to reproductive phase transition of meristem |
| GO:0048765 | Biological Process | root hair cell differentiation |
| GO:0003677 | Molecular Function | DNA binding |
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | MYB-type transcription factor involved in epidermal cell fate specification. Acts as a negative regulator of trichome development, including endoreplication, by mediating lateral inhibition. Promotes the formation of hair developing cells in H position in root epidermis, probably by inhibiting non-hair cell formation. May have pleiotropic effects on flowering development and epidermal cell size through the regulation of endoreduplication. {ECO:0000269|PubMed:18305006}. |
| Annotation --
Nucleotide ? help
Back to Top |
| Source |
Hit ID |
E-value |
Description |
| GenBank | AK118043 | 1e-115 | AK118043.1 Arabidopsis thaliana mRNA for unknown protein, complete cds, clone: RAFL19-27-F14. |
| GenBank | BT005611 | 1e-115 | BT005611.1 Arabidopsis thaliana clone U50786 putative myb family transcription factor (At4g01060) mRNA, complete cds. |
| Publications
? help Back to Top |
- Koiwa H, et al.
C-terminal domain phosphatase-like family members (AtCPLs) differentially regulate Arabidopsis thaliana abiotic stress signaling, growth, and development.
Proc. Natl. Acad. Sci. U.S.A., 2002. 99(16): p. 10893-8
[PMID:12149434] - Nemie-Feyissa D,Olafsdottir SM,Heidari B,Lillo C
Nitrogen depletion and small R3-MYB transcription factors affecting anthocyanin accumulation in Arabidopsis leaves.
Phytochemistry, 2014. 98: p. 34-40
[PMID:24388610] - Wada T,Tominaga-Wada R
CAPRICE family genes control flowering time through both promoting and repressing CONSTANS and FLOWERING LOCUS T expression.
Plant Sci., 2015. 241: p. 260-5
[PMID:26706076] - Tominaga-Wada R,Wada T
The ectopic localization of CAPRICE LIKE MYB3 protein in Arabidopsis root epidermis.
J. Plant Physiol., 2016. 199: p. 111-115
[PMID:27302012] - Hegebarth D,Buschhaus C,Wu M,Bird D,Jetter R
The composition of surface wax on trichomes of Arabidopsis thaliana differs from wax on other epidermal cells.
Plant J., 2016. 88(5): p. 762-774
[PMID:27496682] - Tominaga-Wada R,Wada T
Extended C termini of CPC-LIKE MYB proteins confer functional diversity in Arabidopsis epidermal cell differentiation.
Development, 2017. 144(13): p. 2375-2380
[PMID:28676568] - Huang KC,Lin WC,Cheng WH
Salt hypersensitive mutant 9, a nucleolar APUM23 protein, is essential for salt sensitivity in association with the ABA signaling pathway in Arabidopsis.
BMC Plant Biol., 2018. 18(1): p. 40
[PMID:29490615]
|
